KEGG   Thermoproteus uzoniensis: TUZN_0435Help
Entry
TUZN_0435         CDS       T01460                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    TUZN_0435
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TUZN_0435
Enzymes [BR:tuz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     TUZN_0435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383554..384468
Genome map
AA seq 304 aa AA seqDB search
MSWRGRDVVSMRDFSRKDLEVLFEKAREMERYARSGLDVLRGKIMAVAFFEPSTRTRLSF
ETAMKRLGGNVIGFSSAEGTSVEKGETFSDTIRMLDAYADVIVVRHKLEGAAKLAAEIAQ
SPVINAGDGSFNHPTQAMLDLYTIWREKGKVDGLRIGVMGDLKYARTVNSLLEGLALFDV
EVALISPEFLRPRQETLDYIQSRGLRYEFYSRLDEVLGELDVLYVVRIQKERFLDPLEYE
RVRGSYRLTAESLRGAKDGLIVLHPLPRVDELDPSVDGTRHAAYFRQAAYGVPLRMALLS
LILT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctggcgagggagagacgtagtatctatgcgggacttctccaggaaggatctggag
gtcctcttcgagaaggcgagggagatggagcgatatgccagatcgggcctcgacgtgctt
agggggaaaatcatggctgtggccttcttcgagccctccacacggacccgcctcagcttc
gagacggccatgaagaggctcggcgggaatgtcatcggcttctcgagcgccgaggggacc
agcgtcgagaagggcgagacgttttcggacactataaggatgctcgacgcctacgccgac
gtgatcgtggtgagacacaagcttgagggcgccgccaagcttgcggccgagatagcgcag
tcgccggtcataaacgccggcgatggctcgttcaaccaccccacgcaggccatgttggac
ctatacacgatctggcgggagaaaggcaaggtggacgggttgaggataggcgtgatgggc
gacttgaagtacgcgaggaccgtcaattcgttgctggagggactcgcgttgttcgacgtc
gaggtggccttgatatcgcccgagttcttgaggccgcgccaggagactctggactatata
cagtccagaggcctccgctacgagttctactcgcggctcgatgaggtgttgggagagctc
gacgttctctacgtcgtcaggatacagaaggagaggttcttggaccccctagagtacgag
agagttaggggtagctacaggctcactgcggagtccctaaggggggctaaagacggccta
atagtgctccacccgttgcccagagtagacgagctggatccctccgtggatgggacgaga
cacgcggcctattttaggcaggccgcatacggcgtcccgctgaggatggcgctcctcagc
ttgatcttgacctga

  All links  
No link information was found.   
DBGET integrated database retrieval system