KEGG   Thermoproteus uzoniensis: TUZN_0435Help
Entry
TUZN_0435         CDS       T01460                                 

Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tuz00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tuz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
383554..384468
Genome map
AA seq 304 aa AA seqDB search
MSWRGRDVVSMRDFSRKDLEVLFEKAREMERYARSGLDVLRGKIMAVAFFEPSTRTRLSF
ETAMKRLGGNVIGFSSAEGTSVEKGETFSDTIRMLDAYADVIVVRHKLEGAAKLAAEIAQ
SPVINAGDGSFNHPTQAMLDLYTIWREKGKVDGLRIGVMGDLKYARTVNSLLEGLALFDV
EVALISPEFLRPRQETLDYIQSRGLRYEFYSRLDEVLGELDVLYVVRIQKERFLDPLEYE
RVRGSYRLTAESLRGAKDGLIVLHPLPRVDELDPSVDGTRHAAYFRQAAYGVPLRMALLS
LILT
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgtcctggcgagggagagacgtagtatctatgcgggacttctccaggaaggatctggag
gtcctcttcgagaaggcgagggagatggagcgatatgccagatcgggcctcgacgtgctt
agggggaaaatcatggctgtggccttcttcgagccctccacacggacccgcctcagcttc
gagacggccatgaagaggctcggcgggaatgtcatcggcttctcgagcgccgaggggacc
agcgtcgagaagggcgagacgttttcggacactataaggatgctcgacgcctacgccgac
gtgatcgtggtgagacacaagcttgagggcgccgccaagcttgcggccgagatagcgcag
tcgccggtcataaacgccggcgatggctcgttcaaccaccccacgcaggccatgttggac
ctatacacgatctggcgggagaaaggcaaggtggacgggttgaggataggcgtgatgggc
gacttgaagtacgcgaggaccgtcaattcgttgctggagggactcgcgttgttcgacgtc
gaggtggccttgatatcgcccgagttcttgaggccgcgccaggagactctggactatata
cagtccagaggcctccgctacgagttctactcgcggctcgatgaggtgttgggagagctc
gacgttctctacgtcgtcaggatacagaaggagaggttcttggaccccctagagtacgag
agagttaggggtagctacaggctcactgcggagtccctaaggggggctaaagacggccta
atagtgctccacccgttgcccagagtagacgagctggatccctccgtggatgggacgaga
cacgcggcctattttaggcaggccgcatacggcgtcccgctgaggatggcgctcctcagc
ttgatcttgacctga

DBGET integrated database retrieval system