KEGG   Thermoproteus uzoniensis: TUZN_0510Help
Entry
TUZN_0510         CDS       T01460                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_0510
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TUZN_0510
   00630 Glyoxylate and dicarboxylate metabolism
    TUZN_0510
Enzymes [BR:tuz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TUZN_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(443055..445511)
Genome map
AA seq 818 aa AA seqDB search
MRNMIEINKRVLEEYGDLFGRKVVNGREIVVEQLIEELARELGGEIDAAIRKRKEWHERR
EPVKVKGAFPRWDDKFVDADGNVRTFREIVQGLIDNFLGRDTPLRWGLNQNVPVPDDLHP
LKNPGLEITGPWYPMSRAIHQINADVVSMMEDEEDASPAWYVPWGSGRSVAAVWEARRIV
KRVLSGDVPEPYIEGGKEYRIRKPREKWPTLIHRVPGIHILDFDVRVDGRPVPAIITSVV
LYTANNYDLLKKAGSGVYFYVPKTQTPDEALVVEKILRRVEQRLGLKTGELKIAMLYEEA
RAGLYLPVIFWIWRERLVKINNGRWDYLGSLIEMWREEAVFPDPQNITMTHPIMMAYQKY
NALLTLMAGLDKNGELRAGPVGGMAAVMLYRQGDPYGRERYNARALRGIWIDKLRERLIG
LIFVAEEPAGKVTLGDVLKGKVKGRLYDLFRQSWVATPEEAYVKAGNEPLRASLEELQAM
INKPVKYVEVDGVKIPAVDSGLTEQERALFQRLGLIDENGNITPWVVRKDMVDTPEKLLN
NPELWGGKDLWSALYEPPKGDITIEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFM
NDLATYRIFSTWLWTLLRHEAAVTKDGYLKGPDRTPLGVVPAKNEIAVKAGDRFNREMFE
KLWDLHMQWTNAFYEDFDRIAAERIAGRYDPKVKEALSKAYAAGPFRHISPRAVAEAIAP
LVGKPVDAVEREVVANAPRFDRTFAPVIMEILKAKLTSPLYVQHGGRVVMVLSPLPPEER
EQALMALFGPRDRVERLIAEGKLRKEILEIYDYIHDIR
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaatatgatagagataaacaagcgggttttggaggaatacggcgatctgttcggc
cgcaaggtcgtaaacggcagggagatcgtggtggagcagttgatcgaggagttggcccgg
gagctggggggagagatcgacgccgccataaggaagaggaaggaatggcacgagcggcgt
gagcccgtcaaggtcaagggcgcgttccccagatgggacgacaaattcgtcgatgcggac
ggcaacgtgaggacgtttagggagatagtgcagggcttgatagacaacttcctcggcaga
gacacgccgcttagatggggcctcaaccagaacgtgcccgtccccgacgacctacatcct
ctgaagaaccccggcctcgagataactgggccttggtaccccatgagccgcgccatccac
cagataaacgccgacgtcgtgtcgatgatggaggacgaggaggacgcgtcccccgcctgg
tacgtgccttggggatccgggaggtccgtggccgccgtgtgggaggccaggaggatagtc
aagagggtgctgagcggcgacgtgcccgagccctatatagagggcgggaaggagtacagg
ataaggaagcccagagagaagtggccgacgttgatacacagagtgcccggcatacatata
ctggatttcgacgtcagggtcgacgggaggcccgtccccgccataataacgtccgtggtc
ctctacacggccaacaactacgacttgctcaagaaggccgggtcgggcgtctacttctac
gtgcccaagacccagacccccgacgaggcgctggtcgtggagaagatactgaggagggtc
gagcagaggctggggctcaagactggcgagttgaagatagccatgctttacgaggaggcc
agagccgggctgtacctgccggtcatcttctggatatggagggagaggctggttaagata
aacaacggcaggtgggactacctaggctctctgatagagatgtggagggaggaggcggtg
ttccccgatccccagaacataaccatgacgcaccccataatgatggcctaccagaagtac
aacgccttgctcacgttgatggccgggttggacaaaaacggcgagctgagggccgggcct
gtcggcggcatggccgccgtcatgctctacagacaaggcgatccctacggcagagagcgc
tacaacgccagggcgttgagaggcatctggatagataagctgagggagaggctcataggg
ctcatctttgtggccgaggagcccgcgggcaaggtgaccctcggcgacgtgctcaagggc
aaggtcaaggggaggctctacgacctcttcaggcagagctgggttgcgactcccgaggag
gcctacgtcaaggcgggcaacgagccgttgagggccagcctagaggagctacaggccatg
ataaacaagccggtcaaatacgtcgaggtggacggggtcaagataccggccgtcgacagc
gggttgacggaacaggagcgggccctcttccagaggctcggcttgatagacgagaacggc
aacataacgccgtgggtcgtgaggaaggacatggtggacacgcccgagaagctcctcaac
aaccccgagctgtggggcggcaaggacctctggtcggccctctacgagccgcccaagggc
gacataacgatagagcatatacaacacgccttctacatggcggcaaactacggcttccag
ctcctcaacggcaatctggcagcggccatagacgactacgagctaggccagaggttcatg
aacgacttggccacgtaccgcatattctcgacttggctgtggaccttactgcgccacgag
gcggcggtcaccaaggacggctacttgaaggggcccgacaggacgccgctcggcgtcgtg
ccggccaagaacgagatcgccgtcaaggcaggcgacaggttcaacagagagatgttcgag
aagctctgggacctccacatgcagtggaccaacgcattctacgaggacttcgacaggata
gccgccgagaggatagccggcaggtacgaccccaaggtgaaggaggcgttgtccaaggcc
tacgccgcggggcccttccgccacatatcgcctagagctgttgcggaggccatagcgccc
ttggttggcaagccggtagacgccgtggagcgggaggtcgtcgccaacgccccccgcttc
gacaggacgttcgcccccgtcataatggagatcttgaaggcgaagctcacgtcgccgctc
tacgtgcaacacggcggcagggtagtcatggtgctctcgccgctcccgcccgaggagcgg
gaacaggccttgatggcgctgtttgggccgagagaccgcgtggagaggctcatcgccgaa
ggaaaattaaggaaggaaatattagaaatatatgattatattcacgatataaggtaa

DBGET integrated database retrieval system