KEGG   Thermoproteus uzoniensis: TUZN_0510Help
Entry
TUZN_0510         CDS       T01460                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00620  Pyruvate metabolism
tuz00630  Glyoxylate and dicarboxylate metabolism
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TUZN_0510
   00630 Glyoxylate and dicarboxylate metabolism
    TUZN_0510
Enzymes [BR:tuz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     TUZN_0510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI HAD
Motif
Other DBs
NCBI-ProteinID: AEA12005
UniProt: F2L3M1
Position
complement(443055..445511)
Genome map
AA seq 818 aa AA seqDB search
MRNMIEINKRVLEEYGDLFGRKVVNGREIVVEQLIEELARELGGEIDAAIRKRKEWHERR
EPVKVKGAFPRWDDKFVDADGNVRTFREIVQGLIDNFLGRDTPLRWGLNQNVPVPDDLHP
LKNPGLEITGPWYPMSRAIHQINADVVSMMEDEEDASPAWYVPWGSGRSVAAVWEARRIV
KRVLSGDVPEPYIEGGKEYRIRKPREKWPTLIHRVPGIHILDFDVRVDGRPVPAIITSVV
LYTANNYDLLKKAGSGVYFYVPKTQTPDEALVVEKILRRVEQRLGLKTGELKIAMLYEEA
RAGLYLPVIFWIWRERLVKINNGRWDYLGSLIEMWREEAVFPDPQNITMTHPIMMAYQKY
NALLTLMAGLDKNGELRAGPVGGMAAVMLYRQGDPYGRERYNARALRGIWIDKLRERLIG
LIFVAEEPAGKVTLGDVLKGKVKGRLYDLFRQSWVATPEEAYVKAGNEPLRASLEELQAM
INKPVKYVEVDGVKIPAVDSGLTEQERALFQRLGLIDENGNITPWVVRKDMVDTPEKLLN
NPELWGGKDLWSALYEPPKGDITIEHIQHAFYMAANYGFQLLNGNLAAAIDDYELGQRFM
NDLATYRIFSTWLWTLLRHEAAVTKDGYLKGPDRTPLGVVPAKNEIAVKAGDRFNREMFE
KLWDLHMQWTNAFYEDFDRIAAERIAGRYDPKVKEALSKAYAAGPFRHISPRAVAEAIAP
LVGKPVDAVEREVVANAPRFDRTFAPVIMEILKAKLTSPLYVQHGGRVVMVLSPLPPEER
EQALMALFGPRDRVERLIAEGKLRKEILEIYDYIHDIR
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaatatgatagagataaacaagcgggttttggaggaatacggcgatctgttcggc
cgcaaggtcgtaaacggcagggagatcgtggtggagcagttgatcgaggagttggcccgg
gagctggggggagagatcgacgccgccataaggaagaggaaggaatggcacgagcggcgt
gagcccgtcaaggtcaagggcgcgttccccagatgggacgacaaattcgtcgatgcggac
ggcaacgtgaggacgtttagggagatagtgcagggcttgatagacaacttcctcggcaga
gacacgccgcttagatggggcctcaaccagaacgtgcccgtccccgacgacctacatcct
ctgaagaaccccggcctcgagataactgggccttggtaccccatgagccgcgccatccac
cagataaacgccgacgtcgtgtcgatgatggaggacgaggaggacgcgtcccccgcctgg
tacgtgccttggggatccgggaggtccgtggccgccgtgtgggaggccaggaggatagtc
aagagggtgctgagcggcgacgtgcccgagccctatatagagggcgggaaggagtacagg
ataaggaagcccagagagaagtggccgacgttgatacacagagtgcccggcatacatata
ctggatttcgacgtcagggtcgacgggaggcccgtccccgccataataacgtccgtggtc
ctctacacggccaacaactacgacttgctcaagaaggccgggtcgggcgtctacttctac
gtgcccaagacccagacccccgacgaggcgctggtcgtggagaagatactgaggagggtc
gagcagaggctggggctcaagactggcgagttgaagatagccatgctttacgaggaggcc
agagccgggctgtacctgccggtcatcttctggatatggagggagaggctggttaagata
aacaacggcaggtgggactacctaggctctctgatagagatgtggagggaggaggcggtg
ttccccgatccccagaacataaccatgacgcaccccataatgatggcctaccagaagtac
aacgccttgctcacgttgatggccgggttggacaaaaacggcgagctgagggccgggcct
gtcggcggcatggccgccgtcatgctctacagacaaggcgatccctacggcagagagcgc
tacaacgccagggcgttgagaggcatctggatagataagctgagggagaggctcataggg
ctcatctttgtggccgaggagcccgcgggcaaggtgaccctcggcgacgtgctcaagggc
aaggtcaaggggaggctctacgacctcttcaggcagagctgggttgcgactcccgaggag
gcctacgtcaaggcgggcaacgagccgttgagggccagcctagaggagctacaggccatg
ataaacaagccggtcaaatacgtcgaggtggacggggtcaagataccggccgtcgacagc
gggttgacggaacaggagcgggccctcttccagaggctcggcttgatagacgagaacggc
aacataacgccgtgggtcgtgaggaaggacatggtggacacgcccgagaagctcctcaac
aaccccgagctgtggggcggcaaggacctctggtcggccctctacgagccgcccaagggc
gacataacgatagagcatatacaacacgccttctacatggcggcaaactacggcttccag
ctcctcaacggcaatctggcagcggccatagacgactacgagctaggccagaggttcatg
aacgacttggccacgtaccgcatattctcgacttggctgtggaccttactgcgccacgag
gcggcggtcaccaaggacggctacttgaaggggcccgacaggacgccgctcggcgtcgtg
ccggccaagaacgagatcgccgtcaaggcaggcgacaggttcaacagagagatgttcgag
aagctctgggacctccacatgcagtggaccaacgcattctacgaggacttcgacaggata
gccgccgagaggatagccggcaggtacgaccccaaggtgaaggaggcgttgtccaaggcc
tacgccgcggggcccttccgccacatatcgcctagagctgttgcggaggccatagcgccc
ttggttggcaagccggtagacgccgtggagcgggaggtcgtcgccaacgccccccgcttc
gacaggacgttcgcccccgtcataatggagatcttgaaggcgaagctcacgtcgccgctc
tacgtgcaacacggcggcagggtagtcatggtgctctcgccgctcccgcccgaggagcgg
gaacaggccttgatggcgctgtttgggccgagagaccgcgtggagaggctcatcgccgaa
ggaaaattaaggaaggaaatattagaaatatatgattatattcacgatataaggtaa

DBGET integrated database retrieval system