KEGG   Thermoproteus uzoniensis: TUZN_0535Help
Entry
TUZN_0535         CDS       T01460                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_0535
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TUZN_0535
   00640 Propanoate metabolism
    TUZN_0535
   00660 C5-Branched dibasic acid metabolism
    TUZN_0535
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_0535
Enzymes [BR:tuz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TUZN_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
464173..465321
Genome map
AA seq 382 aa AA seqDB search
MKLYEYEAKEILAKYGVKIPRGRLALTPEEVRKIAEEIGKPVVLKAQVTVAGRGKAGGIK
VAKTPEEAEALARQMFGMTIKGLVVKKIYVTEYQEVEREMYLSLIIDRATRRYLFLASPV
GGIDIEEIAKKEPEKIKRVYVDPFEGLRDFHVRAIVSWLAIKPGTPQWDQAASIVRAMYR
AMTELEAELVESNPLAVTKTGEVVPLDARIIVDDNSLFKHPDLEKAYEEDPRDVTEFERY
AQKIGFNYVELDGDVGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASRDVVKEALKV
LLRHPRVKSIFINIFGGITRADEVAAGIEAALAETGGTNKKIIVRMKGTNEELGRQMLAK
LGIPLYENAEEAAQKAVEAARL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatacgaatacgaggccaaggagatcttggccaaatacggcgtgaagataccc
cgaggaaggctggcgttgacgcccgaagaagtgcgcaaaatcgccgaggagatagggaag
ccggtcgtgttgaaggcgcaagtaaccgtcgctggtagaggcaaggccggcggcataaag
gtcgccaagacgcccgaggaggcggaggcgttggcgaggcagatgttcggcatgaccata
aaggggctggtcgtgaagaagatctacgtaaccgagtaccaggaggtggagagggagatg
tacctgagccttataattgacagagccacaaggcggtatctcttcctggcgtcgccggtg
ggcggcatagacatagaggagatagctaagaaggagcccgagaagataaaacgcgtatac
gtcgacccgttcgaagggcttagggatttccacgtaagggccatagtgtcttggctggcc
ataaagccgggcacgccccagtgggatcaagcggccagcatcgtcagagctatgtatagg
gccatgacggagctggaggccgagctcgtggagtccaacccactggcggtgaccaagacg
ggcgaggtggtgcctctagacgccagaataatcgtcgacgacaactctctgttcaagcat
ccggatctcgagaaggcgtatgaagaggatccgagagacgtgaccgagttcgagcggtac
gcgcagaagatagggttcaactacgtcgagctggacggcgacgtcggcattataggcaac
ggtgcggggctcaccatgagcaccatggacctcgtctaccacttcggggggaggcccgcc
aacttcctcgacataggcggcggcgcgtcccgcgacgtggtcaaggaggcgctgaaggtc
ctcctaaggcatcctcgggtcaagtcgatattcataaacatcttcggcgggatcacgcgc
gccgatgaggtggctgccggcatagaggcggcgttggccgagacaggaggcaccaataag
aagataatagtgagaatgaagggcaccaacgaggagctgggcaggcagatgttggccaag
ttgggaataccgctatacgaaaatgccgaagaggcagcacaaaaagcggtcgaggcggct
aggctatga

DBGET integrated database retrieval system