KEGG   Thermoproteus uzoniensis: TUZN_0535Help
Entry
TUZN_0535         CDS       T01460                                 

Definition
(GenBank) Succinyl-CoA synthetase, subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_0535
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TUZN_0535
   00640 Propanoate metabolism
    TUZN_0535
   00660 C5-Branched dibasic acid metabolism
    TUZN_0535
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_0535
Enzymes [BR:tuz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TUZN_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
464173..465321
Genome map
AA seq 382 aa AA seqDB search
MKLYEYEAKEILAKYGVKIPRGRLALTPEEVRKIAEEIGKPVVLKAQVTVAGRGKAGGIK
VAKTPEEAEALARQMFGMTIKGLVVKKIYVTEYQEVEREMYLSLIIDRATRRYLFLASPV
GGIDIEEIAKKEPEKIKRVYVDPFEGLRDFHVRAIVSWLAIKPGTPQWDQAASIVRAMYR
AMTELEAELVESNPLAVTKTGEVVPLDARIIVDDNSLFKHPDLEKAYEEDPRDVTEFERY
AQKIGFNYVELDGDVGIIGNGAGLTMSTMDLVYHFGGRPANFLDIGGGASRDVVKEALKV
LLRHPRVKSIFINIFGGITRADEVAAGIEAALAETGGTNKKIIVRMKGTNEELGRQMLAK
LGIPLYENAEEAAQKAVEAARL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagttatacgaatacgaggccaaggagatcttggccaaatacggcgtgaagataccc
cgaggaaggctggcgttgacgcccgaagaagtgcgcaaaatcgccgaggagatagggaag
ccggtcgtgttgaaggcgcaagtaaccgtcgctggtagaggcaaggccggcggcataaag
gtcgccaagacgcccgaggaggcggaggcgttggcgaggcagatgttcggcatgaccata
aaggggctggtcgtgaagaagatctacgtaaccgagtaccaggaggtggagagggagatg
tacctgagccttataattgacagagccacaaggcggtatctcttcctggcgtcgccggtg
ggcggcatagacatagaggagatagctaagaaggagcccgagaagataaaacgcgtatac
gtcgacccgttcgaagggcttagggatttccacgtaagggccatagtgtcttggctggcc
ataaagccgggcacgccccagtgggatcaagcggccagcatcgtcagagctatgtatagg
gccatgacggagctggaggccgagctcgtggagtccaacccactggcggtgaccaagacg
ggcgaggtggtgcctctagacgccagaataatcgtcgacgacaactctctgttcaagcat
ccggatctcgagaaggcgtatgaagaggatccgagagacgtgaccgagttcgagcggtac
gcgcagaagatagggttcaactacgtcgagctggacggcgacgtcggcattataggcaac
ggtgcggggctcaccatgagcaccatggacctcgtctaccacttcggggggaggcccgcc
aacttcctcgacataggcggcggcgcgtcccgcgacgtggtcaaggaggcgctgaaggtc
ctcctaaggcatcctcgggtcaagtcgatattcataaacatcttcggcgggatcacgcgc
gccgatgaggtggctgccggcatagaggcggcgttggccgagacaggaggcaccaataag
aagataatagtgagaatgaagggcaccaacgaggagctgggcaggcagatgttggccaag
ttgggaataccgctatacgaaaatgccgaagaggcagcacaaaaagcggtcgaggcggct
aggctatga

DBGET integrated database retrieval system