KEGG   Thermoproteus uzoniensis: TUZN_0621Help
Entry
TUZN_0621         CDS       T01460                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tuz  Thermoproteus uzoniensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(542704..543354)
Genome map
AA seq 216 aa AA seqDB search
MQLDFEKARRRLVEGLISEGILRSENVIEAMLKVPREEFVLPEYRLSAYVDSPLPLLGDA
TISAPHMVAMLCEAVRPREGMRILEVGTGSGYQAAVCAEAIKRRGKVFTIEVEWPLAVFA
AQNIERLGYADVVEVYYGDGALGIPEKAPFDAILVTAAAERVPAALQDQLALGGRLVIPL
EERLGQTLYLYIKSEKGWARERLAYVAFVKLKERRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcagctagatttcgagaaggctaggcggaggctcgtggaggggctcatctctgagggc
atattgaggagcgagaacgtgatagaggccatgctcaaagtaccccgagaggagttcgtg
ttgcccgagtataggctctccgcatatgtggacagcccactgcctctcctcggcgacgcg
accatatcggctccccacatggtggcgatgttgtgcgaggctgtgaggccccgcgagggc
atgaggatattggaggtgggcacaggctcgggctatcaagccgccgtatgcgccgaggcc
atcaagaggaggggaaaggtcttcactatagaggtagagtggccgctcgccgtatttgca
gcccagaacatagagcggctgggctacgccgatgtggtcgaagtctactacggagacggc
gctttgggaattcccgaaaaagccccttttgacgccatattggtcaccgctgcggcggag
cgtgtgccggccgcgttgcaagaccagctcgctctcggcggccgtctggtaataccgctg
gaggagcggctgggccagacgctttacttatatataaagtccgagaagggttgggccaga
gagcggctggcctatgtagcgtttgtcaagctcaaggagcgccgagcgtaa

DBGET integrated database retrieval system