KEGG   Thermoproteus uzoniensis: TUZN_0621Help
Entry
TUZN_0621         CDS       T01460                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tuz  Thermoproteus uzoniensis
Brite
Enzymes [BR:tuz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TUZN_0621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT GCD14 Methyltransf_31 Methyltransf_3 Methyltransf_24 Methyltransf_25 Methyltr_RsmB-F CMAS Ubie_methyltran MTS Methyltransf_11 Methyltransf_18 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: AEA12114
UniProt: F2L458
Position
complement(542704..543354)
Genome map
AA seq 216 aa AA seqDB search
MQLDFEKARRRLVEGLISEGILRSENVIEAMLKVPREEFVLPEYRLSAYVDSPLPLLGDA
TISAPHMVAMLCEAVRPREGMRILEVGTGSGYQAAVCAEAIKRRGKVFTIEVEWPLAVFA
AQNIERLGYADVVEVYYGDGALGIPEKAPFDAILVTAAAERVPAALQDQLALGGRLVIPL
EERLGQTLYLYIKSEKGWARERLAYVAFVKLKERRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcagctagatttcgagaaggctaggcggaggctcgtggaggggctcatctctgagggc
atattgaggagcgagaacgtgatagaggccatgctcaaagtaccccgagaggagttcgtg
ttgcccgagtataggctctccgcatatgtggacagcccactgcctctcctcggcgacgcg
accatatcggctccccacatggtggcgatgttgtgcgaggctgtgaggccccgcgagggc
atgaggatattggaggtgggcacaggctcgggctatcaagccgccgtatgcgccgaggcc
atcaagaggaggggaaaggtcttcactatagaggtagagtggccgctcgccgtatttgca
gcccagaacatagagcggctgggctacgccgatgtggtcgaagtctactacggagacggc
gctttgggaattcccgaaaaagccccttttgacgccatattggtcaccgctgcggcggag
cgtgtgccggccgcgttgcaagaccagctcgctctcggcggccgtctggtaataccgctg
gaggagcggctgggccagacgctttacttatatataaagtccgagaagggttgggccaga
gagcggctggcctatgtagcgtttgtcaagctcaaggagcgccgagcgtaa

DBGET integrated database retrieval system