KEGG   Thermoproteus uzoniensis: TUZN_0691Help
Entry
TUZN_0691         CDS       T01460                                 

Definition
aminopeptidase from family M42
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tuz00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(595048..596136)
Genome map
AA seq 362 aa AA seqDB search
MDDFKPLLKRLSEAFGPSGFEDEVREIVIAEMEPYVDELFVDRWGNVYGVKHGKSDYRAM
VAAHMDEIGLMVDHVEKNGFLRVKPIGGWNEVTLVGQRVVVRTRDGRKIPGVVGTRPPHI
TQPGKEREAPEMKDIFVDIGASSAEEVEKLGVGVGSVAVLDREFAELANGAVTGKAFDDR
VGLAVMLWALRRLRELPVTLYAVATVQEEVGLRGAAVAAERVAPHYAVALDTTIAADVPG
TSEREYVVRLGGGPAIKVMDGGRGGLFIAHPRLRDFVAEVARKEGIPHQMEVLYGGTTDA
MAIAFRREGVPAVAISIPARYVHSPVEVLRVDDAVNAARLLVAVLENASPQFVESLMERR
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgacttcaagcctctgctgaagcgtctgtccgaggccttcggcccctccggcttt
gaggacgaggttagggagatcgtgatcgccgagatggagccctacgtcgacgagctcttc
gtggataggtggggcaacgtctacggcgtcaagcacggcaagtccgactatagggcaatg
gtcgccgcccatatggacgagatagggcttatggtggaccacgtggagaagaacggcttc
ctgagagtcaagccgatcgggggctggaacgaggtgacgttggtggggcagagagtcgtc
gtgaggacgcgggacggcaggaagatcccgggagtcgtggggacgaggcctccccacatc
acgcagccgggcaaggagagggaggcgcccgagatgaaggacatattcgtcgatataggc
gcctccagcgcggaggaggtggagaagctcggcgttggcgtcggctcggtggccgtcctc
gacagagagttcgccgagctcgcaaacggcgccgtcactggcaaggccttcgacgatagg
gtagggctcgccgtaatgttgtgggcgttgaggcggcttcgagagctccctgtgaccctc
tacgccgtcgccacagtgcaggaggaggtagggcttagaggcgccgccgtggctgccgag
agggtcgccccgcattacgcagtcgcgctcgacaccaccatagccgccgacgtgccgggc
acatcggagagggagtacgtcgtgaggctcggcggcggccccgccataaaggtcatggac
ggggggagaggcggcctattcatagcgcatccgaggctcagagacttcgtggccgaggtg
gcgaggaaggaggggataccgcaccagatggaggtcctctacggcggcaccaccgacgcc
atggccatagccttccggcgggagggcgtgcccgcggtcgccataagcatacctgcgcgc
tacgtgcactcccccgtcgaggtccttagggtcgacgacgcggtgaacgccgcgaggctc
ctcgtagcggttctggaaaacgcctccccacagttcgtcgagtcgttgatggagaggaga
attaaatag

DBGET integrated database retrieval system