KEGG   Thermoproteus uzoniensis: TUZN_0691Help
Entry
TUZN_0691         CDS       T01460                                 

Definition
(GenBank) aminopeptidase from family M42
Organism
tuz  Thermoproteus uzoniensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(595048..596136)
Genome map
AA seq 362 aa AA seqDB search
MDDFKPLLKRLSEAFGPSGFEDEVREIVIAEMEPYVDELFVDRWGNVYGVKHGKSDYRAM
VAAHMDEIGLMVDHVEKNGFLRVKPIGGWNEVTLVGQRVVVRTRDGRKIPGVVGTRPPHI
TQPGKEREAPEMKDIFVDIGASSAEEVEKLGVGVGSVAVLDREFAELANGAVTGKAFDDR
VGLAVMLWALRRLRELPVTLYAVATVQEEVGLRGAAVAAERVAPHYAVALDTTIAADVPG
TSEREYVVRLGGGPAIKVMDGGRGGLFIAHPRLRDFVAEVARKEGIPHQMEVLYGGTTDA
MAIAFRREGVPAVAISIPARYVHSPVEVLRVDDAVNAARLLVAVLENASPQFVESLMERR
IK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacgacttcaagcctctgctgaagcgtctgtccgaggccttcggcccctccggcttt
gaggacgaggttagggagatcgtgatcgccgagatggagccctacgtcgacgagctcttc
gtggataggtggggcaacgtctacggcgtcaagcacggcaagtccgactatagggcaatg
gtcgccgcccatatggacgagatagggcttatggtggaccacgtggagaagaacggcttc
ctgagagtcaagccgatcgggggctggaacgaggtgacgttggtggggcagagagtcgtc
gtgaggacgcgggacggcaggaagatcccgggagtcgtggggacgaggcctccccacatc
acgcagccgggcaaggagagggaggcgcccgagatgaaggacatattcgtcgatataggc
gcctccagcgcggaggaggtggagaagctcggcgttggcgtcggctcggtggccgtcctc
gacagagagttcgccgagctcgcaaacggcgccgtcactggcaaggccttcgacgatagg
gtagggctcgccgtaatgttgtgggcgttgaggcggcttcgagagctccctgtgaccctc
tacgccgtcgccacagtgcaggaggaggtagggcttagaggcgccgccgtggctgccgag
agggtcgccccgcattacgcagtcgcgctcgacaccaccatagccgccgacgtgccgggc
acatcggagagggagtacgtcgtgaggctcggcggcggccccgccataaaggtcatggac
ggggggagaggcggcctattcatagcgcatccgaggctcagagacttcgtggccgaggtg
gcgaggaaggaggggataccgcaccagatggaggtcctctacggcggcaccaccgacgcc
atggccatagccttccggcgggagggcgtgcccgcggtcgccataagcatacctgcgcgc
tacgtgcactcccccgtcgaggtccttagggtcgacgacgcggtgaacgccgcgaggctc
ctcgtagcggttctggaaaacgcctccccacagttcgtcgagtcgttgatggagaggaga
attaaatag

DBGET integrated database retrieval system