KEGG   Thermoproteus uzoniensis: TUZN_0993Help
Entry
TUZN_0993         CDS       T01460                                 

Definition
2-oxoglutarate synthase, 2-oxoacid-ferredoxin oxidoreductase A subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_0993
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_0993
   00020 Citrate cycle (TCA cycle)
    TUZN_0993
   00620 Pyruvate metabolism
    TUZN_0993
   00640 Propanoate metabolism
    TUZN_0993
   00650 Butanoate metabolism
    TUZN_0993
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_0993
   00680 Methane metabolism
    TUZN_0993
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_0993
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_0993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(868951..870141)
Genome map
AA seq 396 aa AA seqDB search
MTVQMELGKARQRRIALTGNHAVALAAKMARVEVVAAYPITPQTPAVEKLAEYVNNGELD
AEYIPVEGEHSALSAVVGASAMGARVFTATSSQGLGFMYEILPIAVGLRLPIVMGIATRA
YSAPINVWGDYSDVMSMRELGWIIYMVSNVQEAFDTVIQAYRVGEDPSVHLPVAVAYDGF
WISHVLQPLEVPEDEEDVMRYAPITRSWKKLDVDSPASLGAVGTPEWYFEMRYAAYKALE
DSIKVVAEADAQYGKLFGRSYGFGSAYRLEDADVAIVTYGSIYGLARRAADALRAEGIRA
GALKVRLLRPWPADFLRKSLDGVEKVLVVDRAFNHGGILGPVATELAATLTRPVYNAYAT
IGMRATDSTALRKAAERVAKGEAEPMRPFYIGLRGP
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccagatggagctgggcaaggcgaggcagaggaggatcgcgctcacggggaac
cacgcggtggcgctcgccgccaagatggcccgcgtggaggtcgtggcggcgtaccccata
actccgcagacgcccgccgtggagaagctggcagagtacgtcaacaacggagagctcgac
gcagagtatatcccagtggagggcgagcactcggccctctcggcagtcgtgggggcctcc
gccatgggtgccagggtcttcacggcgactagcagccaggggctcggcttcatgtacgag
atactgcccatagcggtggggctgaggctccccatagtgatgggcatagccacgagggcc
tactcggcccccataaacgtctggggggactacagcgacgtcatgtccatgagggagctg
ggctggataatctacatggtgtctaacgtacaagaggccttcgacacggttatacaggcg
tatagagtcggcgaggatccgtcggtccatctccccgtcgccgtcgcctacgacggcttc
tggataagccacgtgctccagcctctggaggtgcccgaggacgaggaggacgtaatgcgc
tacgccccgataaccaggagctggaagaagctggacgtggacagcccggcctcgctcggc
gcggtggggacgccggagtggtacttcgagatgaggtacgcggcgtataaggcgctggag
gactcgataaaagtagtcgccgaggccgacgcccagtacggcaagctcttcgggaggagc
tacggcttcggctcggcctataggctggaggacgccgacgtggccatagtgacctacggc
tcgatctacggcctggcgaggagggccgcagacgccttgagggccgagggcataagggcg
ggcgccttgaaggtaaggcttctgaggccttggcccgccgactttctgcggaagagcctc
gacggcgtggagaaggtgttggtggtcgacagggcgttcaaccacggagggattctgggc
cccgtcgccacagagctcgccgcaactttgacccgcccggtgtacaacgcctacgccacc
ataggcatgagggcgaccgactcaacggcgttgaggaaggcggcggagcgggtggcgaag
ggcgaggcggagcccatgaggccgttctacatagggctgagggggccatga

DBGET integrated database retrieval system