KEGG   Thermoproteus uzoniensis: TUZN_1029Help
Entry
TUZN_1029         CDS       T01460                                 

Definition
(GenBank) Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00020  Citrate cycle (TCA cycle)
tuz00620  Pyruvate metabolism
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
Module
tuz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1029
   00020 Citrate cycle (TCA cycle)
    TUZN_1029
   00620 Pyruvate metabolism
    TUZN_1029
Enzymes [BR:tuz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TUZN_1029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 PTS_EIIA_1 HlyD_D23 DUF2118 NQRA PYNP_C RnfC_N YqfD GCV_H
Motif
Other DBs
NCBI-ProteinID: AEA12510
UniProt: F2L6B4
Position
902404..903588
Genome map
AA seq 394 aa AA seqDB search
MEFKFPDLGEGLVEGEIVKWHVKEGDYVKEGDPLVDVMTEKATVTLPAPAAGKVVKILAK
EGQVVKVGQTLCVIEPAEGEAKQAERPQAEAAQQAPREVAAMPAARRLARELGVDLAKVK
GTGPGGVITVEDVRRYAEELKAKGGEAPEAPKAAEAPKAVGGAEEAEVIPVRGIRRAVAE
KMTKAKRLVPHAYHLEEVDLTELIRLRERLKAEAERRGVKLTLLPFVARAVALALREFPM
LNSEYDEEKNAIVVRKAVNLGIAVDTEQGLVVVVVRDADRKGVLELAKEIAALAEKARSG
KLDIQDVRGSTFTISNIGAVGGLGGLSILNYPEAAIMAVGQAKKKPWVVEGRIEIRDIAL
VAVSFDHRVVDGAYVARFVNRVRELLERPELLLL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagttcaagttccccgatctgggagagggcctcgtcgagggcgagatcgtcaagtgg
cacgtgaaggagggggactacgtcaaggagggcgatcccctggtagacgtaatgacggag
aaggccacggtcaccctccccgcccccgccgcgggcaaggtagtcaagatcttggccaag
gagggccaggtagtcaaggtgggccagacgctgtgcgtaatcgagccggcggagggcgag
gcgaaacaagccgagaggccccaggccgaggcggcccagcaagccccccgcgaggtggcc
gccatgcctgccgccagaaggctcgccagagagctcggcgtagatctcgccaaggtcaag
ggcacaggccccggcggggtgataacagtcgaggacgtaaggagatatgccgaggagctc
aaggccaagggaggggaggcgccggaggcccccaaagccgccgaggcgcctaaggctgtc
gggggcgccgaggaggcggaggtgatccccgtgaggggcattaggagggccgttgcggag
aagatgacgaaggcgaagaggctcgtcccgcacgcctaccatctggaggaggtggacctc
accgagctcataaggcttcgcgagaggctgaaggccgaggcggagcggcggggcgtcaag
ctgacgcttctgcccttcgtggcgagggccgtcgcgctggcgttgagggagttccctatg
ctgaactccgagtacgacgaggagaagaacgccatagttgtgaggaaggcggtgaacttg
ggcatagccgtagacacagagcagggcctagtggtggtcgtggtgagggacgccgatagg
aagggcgtgttggagctggccaaggagatcgcggcgctcgccgagaaggccaggtccggc
aagctggatatacaagacgtcaggggctccacgttcaccataagcaacataggcgccgtg
ggagggctcggcggcctctccatactcaactaccccgaggccgctatcatggccgtcggc
caggccaagaagaagccgtgggttgtcgagggcaggatagagataagggatatagccctc
gtggcggtcagcttcgaccacagagtggtcgacggggcgtacgtggccaggttcgtgaac
agggtgagggagctcttggagaggcccgagctcctcttgctatga

DBGET integrated database retrieval system