KEGG   Thermoproteus uzoniensis: TUZN_1116Help
Entry
TUZN_1116         CDS       T01460                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1116
   01230 Biosynthesis of amino acids
    TUZN_1116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1116
   00051 Fructose and mannose metabolism
    TUZN_1116
   00562 Inositol phosphate metabolism
    TUZN_1116
Enzymes [BR:tuz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TUZN_1116
Exosome [BR:tuz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TUZN_1116
  Exosomal proteins of bladder cancer cells
   TUZN_1116
  Exosomal proteins of melanoma cells
   TUZN_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961786..962463)
Genome map
AA seq 225 aa AA seqDB search
MKLPILIINFKAYGEAAGRRAVDIAKAAERVSRELGVNVAVAPSHLELALVAQSVGIPVY
AQGADVESPGAYTAHVAVDNVKEAGASGIILNHSEAPLRLNDLARLVARARAAGLDVVVC
APDPKTSLAAAALGPHAVAVEPPELIGTGRAVSKYKPETVVETVELVKRHFPDVAVITGA
GIESGEDVEAALRLGTRGVLLASAAVKAKDHYAKILELARPLAGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgccgatcttgataataaacttcaaggcgtacggcgaggcggcagggcgtagg
gcggtcgatatagccaaggccgcggagagggtgtctagggagctcggcgtcaacgtggcg
gtggccccgagccatctggagctcgccctcgtggcccagtcggtgggcatacctgtctac
gcccagggcgccgacgtggagtccccgggggcctacacggcccacgtggctgtggacaac
gtgaaggaggcgggcgcttcgggcataatattgaaccacagcgaggctcccttgaggctc
aacgacttggcgaggctcgtggctagggccagggcggcgggactcgacgtggtcgtctgc
gcgcccgatcccaagacgagcctcgccgcggccgccctggggcctcacgcggtggccgtc
gagccgcccgagctcatagggacggggagggccgtctccaaatacaagccggagaccgtc
gtcgagaccgtcgagctggtcaagaggcatttccccgacgtcgcggtgatcacgggggcg
gggatagagtcgggggaggacgtcgaggcggcgttgcggctcggcactagaggagttctc
ctggccagcgccgccgtcaaggccaaggatcactacgccaagatactcgagctggcgagg
cctctggccggccgttag

DBGET integrated database retrieval system