KEGG   Thermoproteus uzoniensis: TUZN_1116Help
Entry
TUZN_1116         CDS       T01460                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00051  Fructose and mannose metabolism
tuz00562  Inositol phosphate metabolism
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
tuz01230  Biosynthesis of amino acids
Module
tuz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1116
   00051 Fructose and mannose metabolism
    TUZN_1116
   00562 Inositol phosphate metabolism
    TUZN_1116
Enzymes [BR:tuz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TUZN_1116
Exosome [BR:tuz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TUZN_1116
  Exosomal proteins of bladder cancer cells
   TUZN_1116
  Exosomal proteins of melanoma cells
   TUZN_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS His_biosynth NMO Peripla_BP_6 FMN_dh
Motif
Other DBs
NCBI-ProteinID: AEA12596
UniProt: F2L0B4
Position
complement(961786..962463)
Genome map
AA seq 225 aa AA seqDB search
MKLPILIINFKAYGEAAGRRAVDIAKAAERVSRELGVNVAVAPSHLELALVAQSVGIPVY
AQGADVESPGAYTAHVAVDNVKEAGASGIILNHSEAPLRLNDLARLVARARAAGLDVVVC
APDPKTSLAAAALGPHAVAVEPPELIGTGRAVSKYKPETVVETVELVKRHFPDVAVITGA
GIESGEDVEAALRLGTRGVLLASAAVKAKDHYAKILELARPLAGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgccgatcttgataataaacttcaaggcgtacggcgaggcggcagggcgtagg
gcggtcgatatagccaaggccgcggagagggtgtctagggagctcggcgtcaacgtggcg
gtggccccgagccatctggagctcgccctcgtggcccagtcggtgggcatacctgtctac
gcccagggcgccgacgtggagtccccgggggcctacacggcccacgtggctgtggacaac
gtgaaggaggcgggcgcttcgggcataatattgaaccacagcgaggctcccttgaggctc
aacgacttggcgaggctcgtggctagggccagggcggcgggactcgacgtggtcgtctgc
gcgcccgatcccaagacgagcctcgccgcggccgccctggggcctcacgcggtggccgtc
gagccgcccgagctcatagggacggggagggccgtctccaaatacaagccggagaccgtc
gtcgagaccgtcgagctggtcaagaggcatttccccgacgtcgcggtgatcacgggggcg
gggatagagtcgggggaggacgtcgaggcggcgttgcggctcggcactagaggagttctc
ctggccagcgccgccgtcaaggccaaggatcactacgccaagatactcgagctggcgagg
cctctggccggccgttag

DBGET integrated database retrieval system