KEGG   Thermoproteus uzoniensis: TUZN_1116Help
Entry
TUZN_1116         CDS       T01460                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1116
   01230 Biosynthesis of amino acids
    TUZN_1116
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1116
   00051 Fructose and mannose metabolism
    TUZN_1116
   00562 Inositol phosphate metabolism
    TUZN_1116
Enzymes [BR:tuz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TUZN_1116
Exosome [BR:tuz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TUZN_1116
  Exosomal proteins of bladder cancer cells
   TUZN_1116
  Exosomal proteins of melanoma cells
   TUZN_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(961786..962463)
Genome map
AA seq 225 aa AA seqDB search
MKLPILIINFKAYGEAAGRRAVDIAKAAERVSRELGVNVAVAPSHLELALVAQSVGIPVY
AQGADVESPGAYTAHVAVDNVKEAGASGIILNHSEAPLRLNDLARLVARARAAGLDVVVC
APDPKTSLAAAALGPHAVAVEPPELIGTGRAVSKYKPETVVETVELVKRHFPDVAVITGA
GIESGEDVEAALRLGTRGVLLASAAVKAKDHYAKILELARPLAGR
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgccgatcttgataataaacttcaaggcgtacggcgaggcggcagggcgtagg
gcggtcgatatagccaaggccgcggagagggtgtctagggagctcggcgtcaacgtggcg
gtggccccgagccatctggagctcgccctcgtggcccagtcggtgggcatacctgtctac
gcccagggcgccgacgtggagtccccgggggcctacacggcccacgtggctgtggacaac
gtgaaggaggcgggcgcttcgggcataatattgaaccacagcgaggctcccttgaggctc
aacgacttggcgaggctcgtggctagggccagggcggcgggactcgacgtggtcgtctgc
gcgcccgatcccaagacgagcctcgccgcggccgccctggggcctcacgcggtggccgtc
gagccgcccgagctcatagggacggggagggccgtctccaaatacaagccggagaccgtc
gtcgagaccgtcgagctggtcaagaggcatttccccgacgtcgcggtgatcacgggggcg
gggatagagtcgggggaggacgtcgaggcggcgttgcggctcggcactagaggagttctc
ctggccagcgccgccgtcaaggccaaggatcactacgccaagatactcgagctggcgagg
cctctggccggccgttag

DBGET integrated database retrieval system