KEGG   Thermoproteus uzoniensis: TUZN_1127Help
Entry
TUZN_1127         CDS       T01460                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TUZN_1127
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_1127
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_1127
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TUZN_1127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
972032..973333
Genome map
AA seq 433 aa AA seqDB search
MPEKLRVDLPPEEVPQYWYNILADLPEPLPPPQDPDNGKRLELLKQVVPSEPLRLEFSTE
RYIKIPEEVRERYLQVGRPTPLIRAKRLEEYLDAPVKIYLKMEGYTYTGSHKINSALAWV
HYALRDGAKFVTTETGAGQWGSAVALAAALFKTKAHVFMVKASYYAKPLRRYLMQMYGAE
VHPSPSELTEYGRRLLRENPDHPGSLGVAITEAAEYALRHGGKYVVGSVINADILFKTVA
GLEAKKQLELIGEEPDVFIGVVGGGSNWGGAFYPFIGDELRAGKVRRRYIAVGALEVPKV
TKGVYKYDDPDSGRLLPQLKMYTIGADFVPPPIYAGGLRYHGVAPTLSYLMYKGWVEGRD
YDQETVFRMAQIFAQLEGYVPAPETAHVLPAIKEVADEAKRTGERKVILVSFSGHGLLDL
ANFADVLGFAKGQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaagttgagggtggatctacctcccgaggaggtgccccaatactggtacaac
atactcgccgacttgcccgagccgctcccgccgcctcaagaccccgacaacggcaagagg
ctggagctcttgaaacaggtcgtgccctccgagcccttgaggctggagttctcgaccgag
aggtatatcaagatccccgaagaggtcagggagaggtacttacaggtgggcagacccacg
cccctcataagggccaagaggcttgaggagtacctcgacgcccccgtcaagatatacctc
aagatggagggctacacgtacacggggagccacaagatcaactctgccctcgcctgggtc
cactacgcgttgagggacggggcgaagttcgtcaccaccgagaccggcgcggggcagtgg
ggatccgccgtggctctcgccgccgccctcttcaagaccaaggcccacgtcttcatggtc
aaggcgtcctactacgccaagccgttgaggaggtacttaatgcagatgtacggcgccgag
gtccatccaagccccagcgagctcacggaatacggcaggaggctgctcagggagaacccc
gaccacccgggctcgctcggagtcgccataaccgaggccgctgagtacgccttgaggcac
ggagggaagtacgtcgtcggcagcgtgataaacgccgacatactcttcaagacggtggcc
ggcctcgaggccaagaaacagctcgagctaatcggcgaggagcccgacgtgttcatagga
gtagtcggcggggggtccaactggggaggcgccttctatcccttcataggcgacgagctg
agggcggggaaggtcaggaggaggtatatagctgtgggggccctcgaggtgcccaaggtg
accaagggggtctacaaatacgacgaccccgactccggccgtctactgccccagctcaag
atgtacaccataggcgccgacttcgtgcccccgcccatatacgccggagggctgaggtac
cacggcgtcgcgcccactctgtcgtacttgatgtacaaggggtgggtcgagggcagggac
tacgaccaggagaccgtcttcagaatggcccagatattcgcccagctggagggctacgtc
ccggcgcccgagacggcccacgtcctgccggccataaaggaggtagccgacgaggccaag
aggacgggggagaggaaagtcatactcgtcagcttcagcggacacggccttctggacctc
gccaacttcgccgacgtgctgggcttcgcgaaggggcagtga

DBGET integrated database retrieval system