KEGG   Thermoproteus uzoniensis: TUZN_1311Help
Entry
TUZN_1311         CDS       T01460                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TUZN_1311
Enzymes [BR:tuz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TUZN_1311
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1128677..1129267)
Genome map
AA seq 196 aa AA seqDB search
MLINRSRVGVMLKKEGVEKAEAAVTSLLIHLGEDLSRPGVTNTPKRFVKAMEELTRGLRE
PAPEVVFFPLEYEADPGPVVIENIRAVSLCEHHLLPIVLNISVAYQPGDAVPGLSKVIRL
VKWAAARPIMQERFTEWLADLLMDKLKAKAVKVKVCGVHMCSFIRGVKDEHHTMITEARR
GDLDVRLDCKRPLACR
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgcttataaatagaagtcgggtaggcgtcatgctgaagaaggaaggagtcgaaaaggcg
gaggccgccgtaacgtccttgttgatccacctcggcgaggatctgtcgaggcccggcgtg
accaacacgccgaagcgcttcgtcaaggccatggaggagctcactagggggttgagagag
cctgcgcccgaggtggtcttcttccctctggagtacgaggcggatccgggccccgtcgtt
atcgagaacataagggccgtgtccctctgcgaacaccacctgctccccatagtgctcaac
atatcggtggcctaccagcccggcgacgccgtgccggggctcagcaaggtgataaggctg
gtcaagtgggccgcggcgaggcccataatgcaggagaggttcaccgagtggctggccgac
ctcctcatggataagctgaaggccaaggccgtcaaggtcaaggtatgcggcgtccacatg
tgctccttcataagaggcgtcaaggacgagcaccacacgatgatcactgaggccaggagg
ggcgatctggacgtaaggctcgactgcaaacgccccctggcctgtagatga

DBGET integrated database retrieval system