KEGG   Thermoproteus uzoniensis: TUZN_1448Help
Entry
TUZN_1448         CDS       T01460                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1448
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1448
   00020 Citrate cycle (TCA cycle)
    TUZN_1448
   00620 Pyruvate metabolism
    TUZN_1448
   00640 Propanoate metabolism
    TUZN_1448
   00650 Butanoate metabolism
    TUZN_1448
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_1448
   00680 Methane metabolism
    TUZN_1448
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_1448
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_1448
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1247105..1247626
Genome map
AA seq 173 aa AA seqDB search
MIEIRFHGRGGQGMVTASQVLATAAIMEGKYAQAFPEFGPERRGAPVKAYLRIDDKPIYK
REPVVEPDVVVVGDQSLFVSENPLEGLKQNGILVVNGAYKAPVKTYYVDATSLALKVLGK
AIVNTAMIGAVVKATGVVRLETALAALGKYFSGKIYELNAQLVKIAFDQTKEL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgagataaggttccacggccgcggaggccagggcatggtcacggcctcgcaagtc
ctggcaaccgccgctataatggaggggaaatacgcgcaggcgttcccggagttcggcccc
gagaggcgcggagcccccgtcaaggcgtatctgcgcatagacgacaagccgatatacaag
cgcgagcctgtagtggagcccgacgtcgtggtcgtcggcgaccagtcgcttttcgtctcg
gagaacccgctcgaggggcttaaacagaacgggattctggtcgtcaacggcgcctataag
gcgcccgtaaagacctactacgtcgacgccacatccctcgccttgaaggtattgggcaag
gcaatagtgaacaccgccatgataggcgccgtggtcaaggccaccggcgtggtccgcctc
gagaccgccctcgccgccttgggcaaatacttcagcggcaagatatacgagctaaatgcg
caactggtaaaaatagcatttgatcagaccaaggagctatga

DBGET integrated database retrieval system