KEGG   Thermoproteus uzoniensis: TUZN_1450Help
Entry
TUZN_1450         CDS       T01460                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00020  Citrate cycle (TCA cycle)
tuz00620  Pyruvate metabolism
tuz00633  Nitrotoluene degradation
tuz00640  Propanoate metabolism
tuz00650  Butanoate metabolism
tuz00680  Methane metabolism
tuz00720  Carbon fixation pathways in prokaryotes
tuz01100  Metabolic pathways
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
Module
tuz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
tuz_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1450
   00020 Citrate cycle (TCA cycle)
    TUZN_1450
   00620 Pyruvate metabolism
    TUZN_1450
   00640 Propanoate metabolism
    TUZN_1450
   00650 Butanoate metabolism
    TUZN_1450
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_1450
   00680 Methane metabolism
    TUZN_1450
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_1450
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C ZnuA
Motif
Other DBs
NCBI-ProteinID: AEA12923
UniProt: F2L1R7
Position
1247928..1249118
Genome map
AA seq 396 aa AA seqDB search
MTAAAALQKAKTTLALTSNYAVAYAVKAADVDVVAVYPITPQTTIVEKIAEFVDDGELNA
DLIHVESEHSAMSAVVGAAAAGARVFTATSSQGLELMHEVLHIASGLRLPIVMAVPARAL
SAPISIHGDYSDVMNTRDTGWITYIASSAQEVYDTVIQAYKVAETALLPVMVSYDGFLMS
HTTEPVELNDEEEVRRFLPRKDRPNVLRPEKPITMGAFAMPDWYYEIKYQVQEALMGSLK
VVEEVDAEYGKIFGRSYGIVQTYRMEDADYAIIAYGGAAFGNAREAADIAREKGIKAGAI
RLRVWRPFPTSHLLKQLAGVKAFAVVDRAIAFGSSGGGPVFLDVAAALWMNGIDIPGLSV
IHGIGQRSMYVEDFVKIYEMLKSGERNKVIYMGLRL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgcggcggctctccaaaaggccaagacgacgcttgcgttgaccagcaactac
gcagtagcctatgccgtcaaggccgccgatgtcgacgtcgttgcggtctaccccataacg
ccgcagaccaccatagtggagaagatagccgagttcgtcgacgatggcgagctgaacgcc
gatttgatacatgtagagtcagagcactcggccatgtcggccgtagtcggcgctgcggcc
gccggggctagggtcttcacggcgaccagcagccaggggctcgagctgatgcacgaggtc
ctgcacatagcctcgggcctccgtctgcccattgtgatggccgtgccggcccgcgccctc
tccgcccccataagcatacacggcgactacagcgacgtgatgaacacaagggataccgga
tggataacctacatagcgtcctcggcgcaggaggtctacgacacggtgatacaggcgtac
aaggtggccgagaccgcgttgctccccgtcatggtgtcctacgacggcttcttgatgtcc
cacacgacagagcccgtggagctcaacgacgaggaggaggtgaggcgcttcctccccaga
aaggataggccgaacgtcttaaggcccgagaagccgatcaccatgggcgccttcgctatg
cccgactggtactacgagataaagtaccaggtccaggaggcgttaatgggctctctaaag
gtagtcgaggaggtcgatgcggagtacggcaaaatcttcgggaggagctacgggatagtc
cagacgtacaggatggaggacgccgactatgccataatagcatatggcggagccgccttc
ggcaacgcccgcgaggccgccgacatagctagggagaagggcataaaggcaggcgcgata
aggttgcgggtgtggaggccgttccccacgagccatctgctcaagcaactggccggcgtc
aaggcgtttgcggtggtcgacagagccatcgcgttcggctcatcgggaggagggccggtg
ttcttggacgtggccgccgcgctctggatgaacggcatcgacatacccgggctgtccgtg
atacacggcatagggcaacgctctatgtacgtcgaggacttcgtcaagatatacgagatg
ctgaagagcggcgaaaggaataaagtgatctacatggggctgaggctatga

DBGET integrated database retrieval system