KEGG   Thermoproteus uzoniensis: TUZN_1451Help
Entry
TUZN_1451         CDS       T01460                                 

Definition
pyruvate/ketoisovalerate oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1451
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1451
   00020 Citrate cycle (TCA cycle)
    TUZN_1451
   00620 Pyruvate metabolism
    TUZN_1451
   00640 Propanoate metabolism
    TUZN_1451
   00650 Butanoate metabolism
    TUZN_1451
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_1451
   00680 Methane metabolism
    TUZN_1451
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_1451
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1249115..1250062
Genome map
AA seq 315 aa AA seqDB search
MKVVYKSIWDLPAEELFASGHRACAGCGPAIAMRWITKTAGPNTIVVNATGCMEVTTTQY
PETAWMVPYLHVAFENAAAAAAGIDSAIRVMSKKGLWSSGKTNVVVIAGDGGTYDIGLQS
LSGMLERGHHVLYILYDNEAYMNTGIQRSGGTPRFAWTTTTPVGKAIRGKIQAKKDIMGI
VMAHRVPYAATATISNIVDMANKIKTALEYTAEGPTFLHILAPCPPGWRFPEERTVEAAR
LAVETGYFPLYEYDHGKIRLNPPTSNMVADPKRRKPLREFLKFQGRFAHLTDAEIEELEK
EVVANLEYLAKLASL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtggtgtacaagtcaatctgggatctgccagccgaggagctgtttgcctccggc
caccgcgcctgtgcgggttgcgggcccgccattgccatgaggtggataaccaagaccgcc
gggccgaacaccatcgtggtcaacgccactggctgtatggaggtcaccaccacgcaatac
ccggagaccgcttggatggtgccctacctacacgtcgccttcgagaacgccgcggcggcc
gccgcgggcatcgactcggccataagggtaatgtccaagaaggggctctggagctccggc
aagacaaacgtcgtggtcatagccggcgacggcgggacctacgacataggcctccagtcc
ctcagcggcatgctggagaggggacaccacgtgctctacatactctacgacaacgaggcc
tacatgaacaccggcatacagaggagcggcggcacgccgcgcttcgcctggactaccacg
acgcctgtggggaaggccataagaggcaagatacaggctaagaaggacataatgggtatc
gtgatggcgcatagagtgccctacgccgccaccgccaccatatccaacatagtggacatg
gccaacaagataaagacagcgctggagtacacggcggagggccccaccttcctgcacata
ctggcgccttgcccgccgggctggcgcttccccgaagagcggactgtggaggcggctagg
ctggcggtggagacaggctacttcccgctttacgagtacgaccacgggaagataaggctg
aatccgcccacctcgaacatggtggccgacccgaagcgcaggaagccgctgagggagttc
ttgaagttccagggtaggttcgcgcacttgaccgacgcggagatagaggagctggagaag
gaggtggtcgccaatctggagtatttggccaaactggcttcgctttaa

DBGET integrated database retrieval system