KEGG   Thermoproteus uzoniensis: TUZN_1646Help
Entry
TUZN_1646         CDS       T01460                                 

Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01130  Biosynthesis of antibiotics
tuz01230  Biosynthesis of amino acids
Module
tuz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_1646
Enzymes [BR:tuz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     TUZN_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth NMO NanE FMN_dh ThiG
Motif
Other DBs
NCBI-ProteinID: AEA13112
UniProt: F2L2Z3
Position
1424895..1425617
Genome map
AA seq 240 aa AA seqDB search
MNFLEEVRKSLKYRAERPPPREVPLVDFRKALGDFGIIAEYKRASPSGVIRADLPPWRYF
EELAQYVDAFSVLTEPFWFMGDLRFVPLAKRFKPVLAKDFVLDKRQIDVFFGYGADAVLI
ISEFALDKTVELAEYAKRIGMTPLVEVGDAKTALEVLEYGDYLLGINSRDLRTLDLSFER
ALNVAEAVAGKADFIIESGINKPGQVEMACRKGARGVLIGTALMREPGLAKELREAVKKC
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcttggaagaggtccgcaaatcgctgaagtacagagccgagaggccgccgcct
agggaggtccccctcgtggacttcagaaaggctctgggggatttcggcataatagcggag
tacaagagggcgtcgccgagcggcgtaataagggccgacctgccgccgtggaggtatttc
gaggagctggcccagtacgtagacgccttttccgtcctcactgagccgttctggttcatg
ggagatctccgcttcgtcccgcttgcgaagagatttaagccggttctggcaaaggacttc
gtcctggacaagagacagatagacgtgtttttcggctacggcgcagacgccgtgttgata
atatcagagttcgccctagataagaccgtggagctcgcagaatacgcgaagaggatcggg
atgacgccgctagtcgaggtaggcgacgcgaagaccgcgctggaggtgctcgaatacggc
gactacctcctgggcataaactcccgcgatctgaggacgttggatctgtcgttcgagagg
gccctgaacgtggcggaggccgtggctggcaaggcggacttcataatagagagcggcatc
aacaagcccggccaagtcgagatggcttgcaggaagggggctaggggggtcttgatcggc
accgccttgatgagggagccgggtctcgcaaaggagttgagagaggccgtgaaaaaatgc
tag

DBGET integrated database retrieval system