KEGG   Thermoproteus uzoniensis: TUZN_1722Help
Entry
TUZN_1722         CDS       T01460                                 

Definition
2-ketoisovalerate ferredoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1722
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1722
   00020 Citrate cycle (TCA cycle)
    TUZN_1722
   00620 Pyruvate metabolism
    TUZN_1722
   00640 Propanoate metabolism
    TUZN_1722
   00650 Butanoate metabolism
    TUZN_1722
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_1722
   00680 Methane metabolism
    TUZN_1722
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_1722
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_1722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1493936..1494199)
Genome map
AA seq 87 aa AA seqDB search
MGLALVPVSRPAPGSGGITGTWRTLRPVVDLNKCIDCGICWLYCPESVIDWEKGQKIKID
YTYCKGCGICAHECPTKAIEMVPEAGL
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
gtggggctcgcgttggttcccgtatcaaggcccgcgccgggctccggcgggataaccggc
acctggcgcacgttgaggcccgtagtcgacctcaataagtgcatagactgcggcatatgc
tggctctactgccccgagtccgtgatagactgggagaagggccagaagataaagatagac
tacacctactgcaaggggtgcggcatatgcgcacacgagtgcccgactaaggcaatagag
atggtccccgaggcggggctatga

DBGET integrated database retrieval system