KEGG   Thermoproteus uzoniensis: TUZN_1723Help
Entry
TUZN_1723         CDS       T01460                                 

Definition
(GenBank) 2-ketoisovalerate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00020  Citrate cycle (TCA cycle)
tuz00620  Pyruvate metabolism
tuz00633  Nitrotoluene degradation
tuz00640  Propanoate metabolism
tuz00650  Butanoate metabolism
tuz00680  Methane metabolism
tuz00720  Carbon fixation pathways in prokaryotes
tuz01100  Metabolic pathways
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
Module
tuz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
tuz_M00374  Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1723
   00020 Citrate cycle (TCA cycle)
    TUZN_1723
   00620 Pyruvate metabolism
    TUZN_1723
   00640 Propanoate metabolism
    TUZN_1723
   00650 Butanoate metabolism
    TUZN_1723
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_1723
   00680 Methane metabolism
    TUZN_1723
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    TUZN_1723
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     TUZN_1723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AEA13185
UniProt: F2L3E6
Position
1494431..1494979
Genome map
AA seq 182 aa AA seqDB search
MIEVVFFGRGGMGAVTAAQLLARVATIEGKFGQAIPEFGAERRGAIVRAYLRIDDKPIEV
HSAVTAGDYVVVLDGRIIAQTNVKAFGKPNAVYIVNSKEEAPWYIAIDATSIALKHGLVA
AGWPLVNMIMASAFAAVSKAVTIEGIVKTIPEFVPARAAKANIEAAREAYEIVSKKLLAS
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggtggtcttcttcgggaggggcggcatgggcgctgtgacggctgcccagctc
ctcgcccgcgtggcgactatcgaggggaagttcgggcaggccataccagagttcggggcg
gagcggagaggcgccatagtccgcgcctatctgagaatcgacgacaagcccattgaggtg
cactcggcggttacggcgggcgactacgtcgtggttctcgacggccgtataatcgcccag
accaacgtgaaggctttcggcaagccgaacgcggtatacatagtgaactccaaggaggag
gccccctggtatatagccatagacgctacgtcgatagcgctcaagcacggcttggtggcg
gccggctggcctctcgtgaacatgataatggcgagcgccttcgcggcggtgagcaaggcg
gtgaccatagagggcatagtcaagaccatccccgagttcgtgccggctagggccgccaag
gcgaatatagaggcggctagagaggcctacgagatcgtgtcgaaaaaactgctggcctct
aaggcctag

DBGET integrated database retrieval system