KEGG   Thermoproteus uzoniensis: TUZN_1742Help
Entry
TUZN_1742         CDS       T01460                                 

Definition
fructose-1,6-bisphosphatase
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1742
   01230 Biosynthesis of amino acids
    TUZN_1742
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1742
   00030 Pentose phosphate pathway
    TUZN_1742
   00051 Fructose and mannose metabolism
    TUZN_1742
  Energy metabolism
   00680 Methane metabolism
    TUZN_1742
Enzymes [BR:tuz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     TUZN_1742
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     TUZN_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1511858..1513054
Genome map
AA seq 398 aa AA seqDB search
MKVTISIIKADVGGWPGHAWVHPKMLELAAERLKEAQKRGLLIDYFVYNVGDDISLLMTH
TKGPDHSDIHGLAWDIFKEVTEKVARKYKLYGAGQDLLKEAFSGNVRGMGPQVAELEIEE
RPSEPVITFAADKTEPGAFNLPMYKIFADPFNTAGLVIDPAMHEGFLFEVLDVYEHKVYL
LKTPEDSYSLLGLIGTTGRYIVRRVYRRADGAPAAAVSVERLNLIAGRYVGKDDPVAIIR
AQHGMPAVGEVLEAFAYPHMVHGWMRGSHAGPLMPMRFYQIDAERRIAVGAKMTRFDGPP
KVGALGWQLHDGYLEGPVDLFDDPAFDYTRQLAAQITEYIRRMGPFQPHRLPPEEMEYTT
LPKILAKVKAYGADDYEKNRERYIKEAIAAAEVAASHD
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaccatatcgatcataaaagccgacgtgggcggctggccgggccacgcctgg
gtccaccccaagatgctcgagctagccgccgagaggctgaaggaggcccagaaacgcggc
cttctcatagactacttcgtttacaacgtcggcgacgatatatctcttctgatgacgcac
accaaggggcccgaccacagcgacatacacggactcgcctgggacatattcaaggaggtg
accgagaaagtggcgaggaagtacaagctttacggagccgggcaagacctcctcaaggag
gccttttcgggcaacgtgaggggcatggggccgcaggttgccgagctcgaaatagaggag
aggccctccgagcccgtcataaccttcgccgcggacaagacggagccgggagccttcaac
ttgccgatgtacaagatattcgccgaccccttcaacacggccggcttagtcatagacccg
gcgatgcacgagggcttcctcttcgaggtactggacgtatacgagcacaaggtgtacctc
ctcaagacgcccgaggactcctactcgctgttggggctcataggaactacggggcgttac
atcgtcaggcgggtctacaggagggcggacggggcgccggccgccgcggtgagcgtggag
aggcttaacctgatagcgggccggtatgtgggcaaggacgacccggtcgccataatccgc
gcgcaacacggcatgcctgcggtgggtgaggttctggaggctttcgcgtatccccacatg
gtccacggctggatgcgcggcagccacgccggccctctaatgcccatgcgcttctaccag
atagacgccgagaggaggatagcggttggggccaagatgaccaggttcgacgggccgccg
aaggtcggggccctcggctggcaactgcacgacggatacctcgaggggccggtcgacctc
ttcgacgaccctgccttcgactacacgcgccagctcgccgcccagataaccgagtacata
cgccgcatggggccgttccagccccaccgccttccgccggaggagatggaatatacaact
ctgcccaagatactggccaaggtcaaggcctacggcgcggacgactacgagaagaacagg
gagaggtacatcaaggaggctatcgcagcggccgaggtggcggcctcgcacgactag

DBGET integrated database retrieval system