KEGG   Thermoproteus uzoniensis: TUZN_1743Help
Entry
TUZN_1743         CDS       T01460                                 

Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1743
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1743
   00620 Pyruvate metabolism
    TUZN_1743
   00640 Propanoate metabolism
    TUZN_1743
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_1743
   00680 Methane metabolism
    TUZN_1743
Enzymes [BR:tuz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TUZN_1743
Lipid biosynthesis proteins [BR:tuz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TUZN_1743
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1513342..1515336
Genome map
AA seq 664 aa AA seqDB search
MSLEEKNLPFDEYIYNDKWRSRTIDIKTYWEYHKKSVENLEEFWASIARELEWFRPWEKV
LDASNPPFYKWFVGGELNLSYLAIDRHVKTWRKNKLALIWEGEPVDQTGYPTDRRKFTYY
DLWREVNRVAYMLRNNFGIKKGDRITLYLPMIPELPIAMYAAWRIGAITNVVFSGFSADA
LADRINDSQSRLVITADGFWRRGKVVRLKDIVDKALEKAPSVENVIVYKRLGLNDVPMTE
GRDWFWDKAMAGVPHNAYVEPERIESTHPSYMLYTSGTTGKPKGIVHDTGGWAVHVYATM
KWVFDLRDDDIYWCTADIGWVTGHSYIVLGPMLMGATQVMYEGAPDFPQPDRWWSIIERY
GVTVLYTSPTAIRTFMRFGEEWPRKHDLSTLRIIHSVGEPINPEAWRWAYTNLGYQNVAF
GSTWWMTETGGIVISHAPGLYLVPMKAGTNGPPLPGFEADVVDDNGKPVPPGVKGYLVLK
RPWPGMLQTIWGDPERYIKTYWSRFPGMFYAGDYAIKDKDGYIWVLGRADEVIKVAGHRL
GTYELESALISHPAVAEAAVIGIPDPIKGEVPIAFVVLKQGVAGTDELRKELRQHIRNTV
GPIAEPAQIYFVTKLPKTRSGKIMRRLLRAVATGAPLGDVTTLEDETSVEEAKRAYEELK
KEVS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgaagagaagaacctaccgttcgatgagtatatatacaacgataagtggcga
tcgcgaactatagatatcaagacctactgggaataccacaagaaatcggtcgagaacctt
gaggagttctgggcctccatcgctagggagcttgagtggtttaggccttgggagaaggtt
cttgacgcctctaatccgccgttttataagtggtttgttgggggtgagctgaacctctcc
tatctggctattgataggcatgtcaagacttggcgtaagaacaagctggcgctgatatgg
gaaggagagccggtagaccagacaggataccccacagacaggagaaaattcacctactac
gacctatggagagaagtaaacagagtggcgtacatgttgcggaacaacttcggcataaag
aagggcgaccgcataacgctgtatctgccgatgatacccgagttgcccatagccatgtac
gcggcgtggaggataggcgccataaccaacgtggtgttctcgggcttctcggccgacgcg
ttggccgaccgcataaacgactcgcagagcaggctcgtgataacggcggacggcttctgg
aggagggggaaggtagtgaggcttaaggatatcgtggacaaggctctggagaaggcgccc
tcggtggagaacgtcatagtttacaagaggctcggcctcaacgacgtgcccatgacggag
ggcagagactggttctgggacaaggccatggccggggtgccgcacaacgcctacgtcgag
cccgagaggatagagagcactcacccgtcctacatgctgtatacctccggcaccaccggg
aagcccaagggcatagtccacgacacgggcggctgggccgtccacgtctacgccaccatg
aagtgggtcttcgacttgagggacgacgacatatactggtgcaccgccgacataggctgg
gtcaccggccactcgtacatagtgctcgggcccatgctcatgggcgctacgcaggtgatg
tacgagggcgctccagacttcccgcaacccgaccgctggtggtcgataattgagaggtac
ggcgtcaccgtgctgtacacctcgccgaccgccataaggaccttcatgaggttcggcgag
gagtggcccaggaaacacgacctgtcaactctcagaattatccactcggtgggcgagccc
ataaaccccgaggcgtggaggtgggcctacaccaacctcggctaccagaacgtggccttc
ggctccacgtggtggatgacggagactgggggcatagtgatatcgcacgcgccgggcctc
tacctggtgcctatgaaggccggcacgaacggcccgccgcttcccggcttcgaggcggac
gtagtagacgacaacggcaagcccgtaccgccgggcgtcaagggctatctagtgctcaag
aggccgtggcccggcatgctccagaccatctggggcgatccagagcgctatattaagact
tactggagtaggtttccgggtatgttctatgctggggattacgcgattaaggataaggac
ggctatatctgggtgttggggagagccgacgaggtgattaaagtcgccggacaccgccta
ggcacctacgagctagagtcagccctcatatcccacccagcagtagcggaggcagcagta
ataggcataccagacccaataaagggagaagtacccatagcgtttgtcgtgttgaagcaa
ggcgtggccgggaccgacgagctgaggaaggagctccgccagcacatacgcaacaccgta
ggccccatcgccgagccggcccagatatacttcgtcacgaagctccccaagacgcgctcc
ggcaagataatgaggcgcctcctgagggctgtggcgaccggggcgccgctcggcgacgtg
acgacgttggaggacgagacgtcggtggaggaggcgaagagggcgtacgaggagttaaag
aaggaagtatcataa

DBGET integrated database retrieval system