KEGG   Thermoproteus uzoniensis: TUZN_1879Help
Entry
TUZN_1879         CDS       T01460                                 

Definition
hexokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TUZN_1879
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_1879
   00052 Galactose metabolism
    TUZN_1879
   00500 Starch and sucrose metabolism
    TUZN_1879
   00520 Amino sugar and nucleotide sugar metabolism
    TUZN_1879
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TUZN_1879
   00524 Butirosin and neomycin biosynthesis
    TUZN_1879
Enzymes [BR:tuz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TUZN_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1627207..1628115
Genome map
AA seq 302 aa AA seqDB search
MILAIDVGGTWTRVLLVRRDGSVERREKIRTGADPVGDAARLADGWDFEAVGVGSIGPMD
LRTGWVTAAPNSPSSRFPLVDPLLKFKKPIYVANDCVAAAWGEYVLGGWGVENLAYLTIS
TGLGVGAVVNGHLLLGKEGNAHELGHAVIDIQGGVKCGCGGLGHWEALASGANIPKYFKT
YAERLGRRPPDVRTSEDVFKLYREGDPLAQAFIDHWLDVNAAGIAVITAAYDPEVLVVGG
SVALNHWDIFKAVEDRLRKYTPLTPPAVERAKFGDDEVAIGAAALAIEPPDTLKKFGYPR
GV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatcttggccatagacgtggggggcacctggacgagggtcttgctggtgaggcgcgac
ggctctgtcgagcgccgcgagaagataaggactggggcggatcccgtgggcgacgcggcc
aggctcgccgacggctgggacttcgaggccgtgggggtgggctccataggccctatggat
ctgaggaccgggtgggtcaccgcggcccccaactccccctccagcagattccctctggtg
gaccccctcctcaagttcaagaagcccatatacgtcgccaacgactgcgtcgccgcggcc
tggggcgagtacgtgctcggcggctggggcgtcgagaatctggcgtatctgaccatatcc
acggggctgggggtgggggctgtggtcaacggccacttgttattgggcaaggagggcaac
gcgcacgagctggggcacgccgtcatagacatacagggcggcgtcaagtgcggttgcgga
ggcctgggccactgggaggcgctggccagcggcgccaatatacccaaatactttaagaca
tacgccgagaggctcggcaggcggccgcccgacgtgaggacgtcggaggacgtcttcaag
ctctacagagagggcgaccctctggcccaggcgttcatagaccactggctggacgtgaac
gcggccggcatagccgtgataacggcggcgtacgaccctgaggtgttggtggtgggggga
tccgtggcgctcaaccactgggatatcttcaaggcggtcgaggacaggctgaggaaatac
acgccgctcaccccgccggccgtcgagagggctaagttcggcgacgacgaggtggccata
ggggcggccgccctcgcgatagagccccccgacacgctcaagaaattcggctaccccaga
ggggtctag

DBGET integrated database retrieval system