KEGG   Thermoproteus uzoniensis: TUZN_1879Help
Entry
TUZN_1879         CDS       T01460                                 

Definition
hexokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tuz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tuz00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tuz00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tuz00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tuz00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:tuz00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1627207..1628115
Genome map
AA seq 302 aa AA seqDB search
MILAIDVGGTWTRVLLVRRDGSVERREKIRTGADPVGDAARLADGWDFEAVGVGSIGPMD
LRTGWVTAAPNSPSSRFPLVDPLLKFKKPIYVANDCVAAAWGEYVLGGWGVENLAYLTIS
TGLGVGAVVNGHLLLGKEGNAHELGHAVIDIQGGVKCGCGGLGHWEALASGANIPKYFKT
YAERLGRRPPDVRTSEDVFKLYREGDPLAQAFIDHWLDVNAAGIAVITAAYDPEVLVVGG
SVALNHWDIFKAVEDRLRKYTPLTPPAVERAKFGDDEVAIGAAALAIEPPDTLKKFGYPR
GV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatcttggccatagacgtggggggcacctggacgagggtcttgctggtgaggcgcgac
ggctctgtcgagcgccgcgagaagataaggactggggcggatcccgtgggcgacgcggcc
aggctcgccgacggctgggacttcgaggccgtgggggtgggctccataggccctatggat
ctgaggaccgggtgggtcaccgcggcccccaactccccctccagcagattccctctggtg
gaccccctcctcaagttcaagaagcccatatacgtcgccaacgactgcgtcgccgcggcc
tggggcgagtacgtgctcggcggctggggcgtcgagaatctggcgtatctgaccatatcc
acggggctgggggtgggggctgtggtcaacggccacttgttattgggcaaggagggcaac
gcgcacgagctggggcacgccgtcatagacatacagggcggcgtcaagtgcggttgcgga
ggcctgggccactgggaggcgctggccagcggcgccaatatacccaaatactttaagaca
tacgccgagaggctcggcaggcggccgcccgacgtgaggacgtcggaggacgtcttcaag
ctctacagagagggcgaccctctggcccaggcgttcatagaccactggctggacgtgaac
gcggccggcatagccgtgataacggcggcgtacgaccctgaggtgttggtggtgggggga
tccgtggcgctcaaccactgggatatcttcaaggcggtcgaggacaggctgaggaaatac
acgccgctcaccccgccggccgtcgagagggctaagttcggcgacgacgaggtggccata
ggggcggccgccctcgcgatagagccccccgacacgctcaagaaattcggctaccccaga
ggggtctag

DBGET integrated database retrieval system