KEGG   Thermoproteus uzoniensis: TUZN_1941Help
Entry
TUZN_1941         CDS       T01460                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TUZN_1941
Enzymes [BR:tuz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TUZN_1941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1684051..1684839)
Genome map
AA seq 262 aa AA seqDB search
MVGVPMEDTLSFKPGTRFAPAKIRQILPYLEYNTVFGNVESPCDVGDVELLRGAPAENLA
NIERVLRDLGPPWVMIGGEHTATLAALRAARPKTYVHIDAHMDTRDEWPPGQKLSHATFV
RRAAEELGLYVIYIAVRAFDDEELRYAKSNGFYVVDGNRRISRSQILDALSTSTGPVYAS
LDLDVMDPSEFPAVGTPEAGGLSFRELEGIYVDVLLAARPLAVDIVEYSPVNDPTDVGAT
KVVRLMLTATRILDAVRSRGSV
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggtcggagtgcccatggaggatacgttgagcttcaagccaggcacgagattcgcgccg
gctaagataaggcagatattgccctacctagagtacaacacggtcttcggcaacgtcgaa
agtccctgcgatgttggcgatgtggagctactacggggagcccccgccgagaacctggcg
aatatagaacgcgttttgagggatctgggaccgccttgggtgatgataggcggcgagcac
acagcaaccctggcggctctcagagcagcccggccgaagacctacgtgcacatagacgcc
cacatggacacaagggacgagtggccgcctggccagaagctatcacacgcgaccttcgtg
aggcgcgccgccgaggagctcggcctttatgtaatatatatagctgtgagggccttcgac
gacgaggagcttagatacgccaagtccaacgggttctacgtagtcgacggcaataggagg
atctccagaagccagatcctagacgccttgtcgacgtcgacggggcccgtctacgcgtcc
ctcgacctagacgtcatggatccgtcggagttccccgccgtggggacgcccgaggcggga
gggctcagcttcagagagttggagggcatctacgtagacgtgttgctagccgccaggccg
ttggccgtggacatagttgagtactcccccgtcaacgaccccacagatgtaggcgccacc
aaggtggtcagacttatgttgaccgcgacgaggatactcgacgcagtcagatcgcgggga
tccgtttaa

DBGET integrated database retrieval system