KEGG   Thermoproteus uzoniensis: TUZN_1981Help
Entry
TUZN_1981         CDS       T01460                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TUZN_1981
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     TUZN_1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715850..1716476
Genome map
AA seq 208 aa AA seqDB search
MSVVIVRLKEGPCPKGAECISIGSISPRAGVSIPDGDYLVVMSPAVARAVDIKAVRERFK
CVICVGPTTASAVGGCLVPREYSSYGVARLIKEMAPGRVVVLRSSAGNDILRRLLPDAVE
VPVYDISIDKDKLREAAEMVARSSVVVLTSATVADKIAPLVDLRGKKVVAIGPVTSARLA
SLGIPHVVAAESTIEGAFKTALSLLGQS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttgtaatagtcaggctcaaggagggcccttgccccaagggcgccgagtgtata
tctatagggtccatatcgccgcgcgcgggcgtgtcgataccggatggagactatctggtc
gtgatgagtcccgcagtggcgcgagcagtcgacataaaggccgtcagggagaggttcaag
tgcgtcatatgcgtcgggcctacgaccgcgtcggcagttggaggctgtctcgtgccgcgg
gagtacagtagctacggcgtcgcgcgcctgattaaggaaatggcgccgggaagggtcgtg
gtcttgagatccagtgcgggcaacgacatattgaggaggcttctgccggacgcggtcgag
gtgccggtgtacgacatatccatagacaaggataaactgagggaggccgcggagatggtc
gcaagatctagcgtcgtagtgttgaccagcgctactgtcgccgacaagatcgcaccgctc
gtcgatcttaggggcaagaaagtagtggctatagggcctgtgacgtcggcgcgtctggcg
tccctgggcataccccacgtagttgcggccgagtcaacgatagagggcgcgtttaagact
gccctatcgcttctagggcagagctaa

DBGET integrated database retrieval system