KEGG   Thermoproteus uzoniensis: TUZN_1983Help
Entry
TUZN_1983         CDS       T01460                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tuz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1717151..1718167
Genome map
AA seq 338 aa AA seqDB search
MQLSFPTSRPRRLRANKLVRDAVAETSLSPDDFIMPIFVKDGAGKEPIDSMPGYFRWPVD
GSLVEHVEEALSLGVNKFILFGVLPDDVKDPEGKASYDPQGVVPRAIRLLKETFGDRVLL
FADVCLCEYTDHGHCGVVVRDGRGWRIDNDRTISIYAKEAVVYADAGADFVAPSGMMDGQ
VRAIRQALDAAGYQDVGIMAYSAKYASAFYGPFRVAASSAPKFGDRRTYQMDPRNSREAV
KEVMLDIEEGADIVMVKPALAYLDVVRLVKDWFPWVPLAAYSVSGEYSMIKAAAKMGYLD
ERLVALEALFAIKRAGADLILTYYALDAARWLREGTPF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctgtctttccccacctcgagacctagaaggctgagggctaacaagctcgtgagg
gatgcagtggccgagacgtcgctatcgcccgacgactttataatgcctatattcgtcaaa
gacggcgcgggcaaagagcccatagactccatgccgggctacttcagatggcccgtcgac
ggctcgttggtcgaacacgtggaggaggcgctcagcctgggcgtgaacaagttcatactc
ttcggcgtcctgcctgacgacgttaaggatcccgaaggcaaggcgtcctacgatccccaa
ggcgtggttccccgggcgattaggctacttaaggaaaccttcggcgacagagttctccta
ttcgccgatgtgtgcctctgcgaatacaccgaccacggccactgcggcgtcgtggtccgg
gacgggagaggatggcgtatagataatgataggacgatctctatatacgccaaggaggcg
gtcgtgtacgcagacgccggcgccgactttgttgcccccagcggtatgatggacggccaa
gtgagggcaataaggcaggccctagacgccgccgggtatcaagacgtaggcataatggct
tattcggccaaatacgcgtcggcgttctacggccccttccgtgtcgcggcgtcttcggcg
cctaagttcggcgataggaggacgtaccagatggatccgcgcaattcgagagaggccgtg
aaagaggtcatgttagatatcgaggaaggcgctgacatagtcatggtcaagccggctctg
gcctacctagacgtggtgaggctggtcaaggactggttcccttgggtgcccctggcggcc
tacagcgtatccggcgaatactccatgataaaggccgcggccaagatggggtacctcgac
gaacggctggtagctctggaggctctatttgctataaagagggccggcgccgatctgata
ctgacatattacgcactagacgccgctaggtggctgagagagggcacgccgttttaa

DBGET integrated database retrieval system