KEGG   Thermoproteus uzoniensis: TUZN_1983Help
Entry
TUZN_1983         CDS       T01460                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TUZN_1983
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TUZN_1983
Exosome [BR:tuz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TUZN_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1717151..1718167
Genome map
AA seq 338 aa AA seqDB search
MQLSFPTSRPRRLRANKLVRDAVAETSLSPDDFIMPIFVKDGAGKEPIDSMPGYFRWPVD
GSLVEHVEEALSLGVNKFILFGVLPDDVKDPEGKASYDPQGVVPRAIRLLKETFGDRVLL
FADVCLCEYTDHGHCGVVVRDGRGWRIDNDRTISIYAKEAVVYADAGADFVAPSGMMDGQ
VRAIRQALDAAGYQDVGIMAYSAKYASAFYGPFRVAASSAPKFGDRRTYQMDPRNSREAV
KEVMLDIEEGADIVMVKPALAYLDVVRLVKDWFPWVPLAAYSVSGEYSMIKAAAKMGYLD
ERLVALEALFAIKRAGADLILTYYALDAARWLREGTPF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgcagctgtctttccccacctcgagacctagaaggctgagggctaacaagctcgtgagg
gatgcagtggccgagacgtcgctatcgcccgacgactttataatgcctatattcgtcaaa
gacggcgcgggcaaagagcccatagactccatgccgggctacttcagatggcccgtcgac
ggctcgttggtcgaacacgtggaggaggcgctcagcctgggcgtgaacaagttcatactc
ttcggcgtcctgcctgacgacgttaaggatcccgaaggcaaggcgtcctacgatccccaa
ggcgtggttccccgggcgattaggctacttaaggaaaccttcggcgacagagttctccta
ttcgccgatgtgtgcctctgcgaatacaccgaccacggccactgcggcgtcgtggtccgg
gacgggagaggatggcgtatagataatgataggacgatctctatatacgccaaggaggcg
gtcgtgtacgcagacgccggcgccgactttgttgcccccagcggtatgatggacggccaa
gtgagggcaataaggcaggccctagacgccgccgggtatcaagacgtaggcataatggct
tattcggccaaatacgcgtcggcgttctacggccccttccgtgtcgcggcgtcttcggcg
cctaagttcggcgataggaggacgtaccagatggatccgcgcaattcgagagaggccgtg
aaagaggtcatgttagatatcgaggaaggcgctgacatagtcatggtcaagccggctctg
gcctacctagacgtggtgaggctggtcaaggactggttcccttgggtgcccctggcggcc
tacagcgtatccggcgaatactccatgataaaggccgcggccaagatggggtacctcgac
gaacggctggtagctctggaggctctatttgctataaagagggccggcgccgatctgata
ctgacatattacgcactagacgccgctaggtggctgagagagggcacgccgttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system