KEGG   Thermoproteus uzoniensis: TUZN_2066Help
Entry
TUZN_2066         CDS       T01460                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00071  Fatty acid degradation
tuz00350  Tyrosine metabolism
tuz00625  Chloroalkane and chloroalkene degradation
tuz00626  Naphthalene degradation
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_2066
  Lipid metabolism
   00071 Fatty acid degradation
    TUZN_2066
  Amino acid metabolism
   00350 Tyrosine metabolism
    TUZN_2066
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    TUZN_2066
   00626 Naphthalene degradation
    TUZN_2066
Enzymes [BR:tuz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     TUZN_2066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C TrkA_N Radical_SAM
Motif
Other DBs
NCBI-ProteinID: AEA13524
UniProt: F2L599
Position
1786657..1787700
Genome map
AA seq 347 aa AA seqDB search
MRKAIYMRAARFYGPGKPLAIEEVPRPSPGPGEVLVRVKAAGVCHTELHFLDGILNLGVM
PITLGHEIAGVVEEVGPGVDDPKPGDRVIVYYYVGCGRCRHCLRGEENLCENPKAEYGFI
TDGGYAEYVKVPARNAVKLPDNIPFEQAAPIGCSVTTAIHATKRARPEMGEYVAVYGVGA
VGFALIQYNKLIGAKVIAIGRSERKLALARELGADYVINARSEDVVRKALEITGGRGVDV
VYELVGVKETMDNSLKMLAKRGRLVLIGYWRDKLEANPLDLVVKEAVITASVGNTLEELI
EAVRLVSEGKIKVVVDRVVGLSKINEELERLRRGEVVGRVVINPEAP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagccatttatatgcgggcggctaggttctatgggcctggaaagcctctggcg
atcgaggaagtgcccaggcccagcccggggcccggcgaggtgctcgtcagggtaaaagcc
gccggcgtctgccacaccgaactgcatttcctagacggcatactcaatctaggagttatg
ccaataacgttgggccacgagatagctggagtcgtggaggaggtaggcccgggcgtcgac
gaccccaagccgggcgatagggtgattgtgtattactatgtcgggtgcggcagatgtagg
cactgcctgagaggcgaggagaatctctgcgagaaccccaaggccgagtacggattcata
accgacggcgggtacgccgagtacgtgaaggtgcctgcgaggaacgccgtgaagctcccc
gacaatatccccttcgagcaggccgcgcctatagggtgtagcgtcacgacggccatacac
gccaccaagagggcgaggccggagatgggcgagtacgtggcagtctacggcgtaggggcc
gtgggcttcgcattgatacagtacaacaagcttatcggcgcgaaggtaatagccataggc
agatccgagaggaagcttgcgctggctcgggagctgggcgccgattacgtcataaacgcc
aggtccgaggacgtggtgaggaaggccctggagataactggcgggcgcggcgtcgacgtg
gtgtacgagctggtgggcgttaaggagaccatggataattccctcaagatgttggccaag
agagggcgcctggtcctgataggctattggcgcgacaagctggaggccaacccgctggat
ctagtggtgaaggaggccgtaataacggcgtcggtggggaatacgctggaggagcttatt
gaggcggtgcgcctggtctctgagggcaagataaaggtggtcgtcgatagggtcgtcggg
ctcagcaagataaacgaggagctcgaaaggcttaggagaggcgaggtcgtgggcagggtc
gttatcaaccccgaggcgccttga

DBGET integrated database retrieval system