KEGG   Thermoproteus uzoniensis: TUZN_2096Help
Entry
TUZN_2096         CDS       T01460                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00260  Glycine, serine and threonine metabolism
tuz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01130  Biosynthesis of antibiotics
tuz01230  Biosynthesis of amino acids
Module
tuz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_2096
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_2096
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TUZN_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA NanE FMN_dh His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: AEA13553
UniProt: F2L5C8
Position
1814251..1814976
Genome map
AA seq 241 aa AA seqDB search
MAALPRPGLGVYITANWPNRDVFAKFLDAVKGIADFVEIGIPTDNPKYDGPFIRSSHRSV
QVKGLDALRGLRLPENAVLMGYAEDFAGRFDELARAAAEAGAVSVLLPDLLIDMPEMLDA
YVAAMRREGLAPTFFLPGKFPYALAERLAGYGPLFIYVGLYAATGIKLPVYVERNIKLAR
SHIGGIYLVAGFAIDSPDKARALIEAGADGLVVGTAAMRRLAEGGVKAAVDFLSEIRRAI
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgttgcctaggccaggcctcggcgtgtacataaccgcgaactggcccaaccgc
gacgtcttcgcgaagttcctcgacgccgttaagggcatcgccgacttcgtggagataggg
atacctacggataacccgaaatacgacggccccttcataaggtccagccatagatccgtg
caggtcaagggcctcgacgcgttgagggggctgagattgcccgagaacgccgtcttgatg
ggctacgccgaggatttcgccggaaggttcgacgagctggccagagcggccgccgaggcg
ggcgccgtctcggtcctcctccccgatctcttgatagatatgccagagatgctcgacgcc
tacgtggcggcgatgaggagggaggggctggcgcccacgttcttcctccccggcaagttc
ccatacgcattagccgaaaggctggccggctacggccctctattcatatacgtgggccta
tacgcggcgaccggcattaagttgcccgtctacgtcgagaggaatatcaagcttgccaga
agccacataggcggcatctacctagtcgcgggcttcgcgatagatagccccgacaaggcg
agggccctaatcgaggcgggggccgacgggcttgtggtgggcaccgccgccatgaggcgg
ctcgccgaaggcggcgtgaaggccgccgtcgacttcctctcggagatacggagggcgatt
aaatga

DBGET integrated database retrieval system