KEGG   Thermoproteus uzoniensis: TUZN_2096Help
Entry
TUZN_2096         CDS       T01460                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TUZN_2096
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_2096
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_2096
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TUZN_2096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1814251..1814976
Genome map
AA seq 241 aa AA seqDB search
MAALPRPGLGVYITANWPNRDVFAKFLDAVKGIADFVEIGIPTDNPKYDGPFIRSSHRSV
QVKGLDALRGLRLPENAVLMGYAEDFAGRFDELARAAAEAGAVSVLLPDLLIDMPEMLDA
YVAAMRREGLAPTFFLPGKFPYALAERLAGYGPLFIYVGLYAATGIKLPVYVERNIKLAR
SHIGGIYLVAGFAIDSPDKARALIEAGADGLVVGTAAMRRLAEGGVKAAVDFLSEIRRAI
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgttgcctaggccaggcctcggcgtgtacataaccgcgaactggcccaaccgc
gacgtcttcgcgaagttcctcgacgccgttaagggcatcgccgacttcgtggagataggg
atacctacggataacccgaaatacgacggccccttcataaggtccagccatagatccgtg
caggtcaagggcctcgacgcgttgagggggctgagattgcccgagaacgccgtcttgatg
ggctacgccgaggatttcgccggaaggttcgacgagctggccagagcggccgccgaggcg
ggcgccgtctcggtcctcctccccgatctcttgatagatatgccagagatgctcgacgcc
tacgtggcggcgatgaggagggaggggctggcgcccacgttcttcctccccggcaagttc
ccatacgcattagccgaaaggctggccggctacggccctctattcatatacgtgggccta
tacgcggcgaccggcattaagttgcccgtctacgtcgagaggaatatcaagcttgccaga
agccacataggcggcatctacctagtcgcgggcttcgcgatagatagccccgacaaggcg
agggccctaatcgaggcgggggccgacgggcttgtggtgggcaccgccgccatgaggcgg
ctcgccgaaggcggcgtgaaggccgccgtcgacttcctctcggagatacggagggcgatt
aaatga

DBGET integrated database retrieval system