KEGG   Thermoproteus uzoniensis: TUZN_2098Help
Entry
TUZN_2098         CDS       T01460                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00260  Glycine, serine and threonine metabolism
tuz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01130  Biosynthesis of antibiotics
tuz01230  Biosynthesis of amino acids
Module
tuz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_2098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_2098
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TUZN_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEA13555
UniProt: F2L5D0
Position
1815827..1817059
Genome map
AA seq 410 aa AA seqDB search
MDRWYNIGADLPIPLPPPKDPDDGDSRIALLTKILPSALIDQEFTAERWIPIPEEVREAY
ARMGRPTPFRRAEGFERKLGVKVHIYYKYEGALPVGSHKLNTALAQAYYAKLDGAEEVAT
ETGAGQWGMAVSLAAALFGLKATVFMTRSSYNSKRQRVTFMKAYGATVYPSPSDVTETGR
KFNKPDHPGSLGIAISEAVEYTLAGERRRYLPGSVLEFVLIHQSVIGLEAIEQMPEEPDY
AVGCVGGGSNFGGFTYPMIGMKLRGEGFEKTRFLAAESAAAPKLTSGDYRYDFPDAVGVL
PMIKMYTLGHDFVPPAVHAAGLRYHGAAPSLSVLKRLGLVEAVAYRQEEVFEAAVMFARS
EGIIPAPESSHAIRAVADLAKKLPPGSVIAFNLSGHGLLDVDAYEKAHVA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggataggtggtacaacataggtgccgatctgcccatcccgttacctccgcctaaagat
ccagacgatggcgatagcagaatcgcgttgctcaccaaaattctgccctcggcgttgata
gaccaggagttcaccgcggagcgctggataccgataccggaggaggtcagagaggcctac
gcgcggatggggaggcccacgccgttcagaagagccgaggggttcgagaggaagctcggc
gtgaaggtccatatctactataaatacgagggggctctgccggtcggaagccacaagttg
aacacggcgctggcccaggcctactacgcgaagctggacggcgccgaggaggtagccacc
gagacaggcgcaggacagtggggcatggccgtgtcgctggcggccgccttgttcggcctc
aaggccactgtgttcatgacgaggtcttcctacaacagcaaaaggcagagggtcacattc
atgaaggcgtatggggcgaccgtctacccgagccccagcgacgtgaccgagaccgggagg
aagttcaacaagcccgaccatccgggctccctcggaatagctatctcggaggctgttgag
tacaccttggccggcgagaggaggcggtatctgccgggtagcgttctcgagttcgtcttg
atacaccagtcggtcatcggccttgaggccatcgagcaaatgcctgaggagcccgactac
gctgtcggctgtgtgggcggcggctctaacttcggaggcttcacgtatccaatgataggg
atgaagctgaggggcgagggcttcgagaagacgaggttcctggccgccgagtctgccgcc
gcgcctaagctcacgtcgggcgactaccgctacgacttcccggacgccgttggggtattg
cccatgattaagatgtacacgctcggccacgacttcgtcccgccggcggtccacgcagcg
ggcctccgctaccacggcgccgcccccagcctctcggtcctcaaaaggctgggcttggtc
gaggcggtggcctataggcaggaggaggtcttcgaggcagccgtcatgttcgcgaggtcc
gaaggtataataccggcgcccgagagctcccacgcaataagggcggtcgcagatctcgcc
aagaagttgcctccgggctccgtcatagcgttcaacctgtccggccacgggcttctggac
gtagacgcgtacgagaaggcccatgtcgcttaa

DBGET integrated database retrieval system