KEGG   Thermoproteus uzoniensis: TUZN_2098Help
Entry
TUZN_2098         CDS       T01460                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TUZN_2098
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_2098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_2098
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TUZN_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815827..1817059
Genome map
AA seq 410 aa AA seqDB search
MDRWYNIGADLPIPLPPPKDPDDGDSRIALLTKILPSALIDQEFTAERWIPIPEEVREAY
ARMGRPTPFRRAEGFERKLGVKVHIYYKYEGALPVGSHKLNTALAQAYYAKLDGAEEVAT
ETGAGQWGMAVSLAAALFGLKATVFMTRSSYNSKRQRVTFMKAYGATVYPSPSDVTETGR
KFNKPDHPGSLGIAISEAVEYTLAGERRRYLPGSVLEFVLIHQSVIGLEAIEQMPEEPDY
AVGCVGGGSNFGGFTYPMIGMKLRGEGFEKTRFLAAESAAAPKLTSGDYRYDFPDAVGVL
PMIKMYTLGHDFVPPAVHAAGLRYHGAAPSLSVLKRLGLVEAVAYRQEEVFEAAVMFARS
EGIIPAPESSHAIRAVADLAKKLPPGSVIAFNLSGHGLLDVDAYEKAHVA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggataggtggtacaacataggtgccgatctgcccatcccgttacctccgcctaaagat
ccagacgatggcgatagcagaatcgcgttgctcaccaaaattctgccctcggcgttgata
gaccaggagttcaccgcggagcgctggataccgataccggaggaggtcagagaggcctac
gcgcggatggggaggcccacgccgttcagaagagccgaggggttcgagaggaagctcggc
gtgaaggtccatatctactataaatacgagggggctctgccggtcggaagccacaagttg
aacacggcgctggcccaggcctactacgcgaagctggacggcgccgaggaggtagccacc
gagacaggcgcaggacagtggggcatggccgtgtcgctggcggccgccttgttcggcctc
aaggccactgtgttcatgacgaggtcttcctacaacagcaaaaggcagagggtcacattc
atgaaggcgtatggggcgaccgtctacccgagccccagcgacgtgaccgagaccgggagg
aagttcaacaagcccgaccatccgggctccctcggaatagctatctcggaggctgttgag
tacaccttggccggcgagaggaggcggtatctgccgggtagcgttctcgagttcgtcttg
atacaccagtcggtcatcggccttgaggccatcgagcaaatgcctgaggagcccgactac
gctgtcggctgtgtgggcggcggctctaacttcggaggcttcacgtatccaatgataggg
atgaagctgaggggcgagggcttcgagaagacgaggttcctggccgccgagtctgccgcc
gcgcctaagctcacgtcgggcgactaccgctacgacttcccggacgccgttggggtattg
cccatgattaagatgtacacgctcggccacgacttcgtcccgccggcggtccacgcagcg
ggcctccgctaccacggcgccgcccccagcctctcggtcctcaaaaggctgggcttggtc
gaggcggtggcctataggcaggaggaggtcttcgaggcagccgtcatgttcgcgaggtcc
gaaggtataataccggcgcccgagagctcccacgcaataagggcggtcgcagatctcgcc
aagaagttgcctccgggctccgtcatagcgttcaacctgtccggccacgggcttctggac
gtagacgcgtacgagaaggcccatgtcgcttaa

DBGET integrated database retrieval system