KEGG   Thermoproteus uzoniensis: TUZN_2098Help
Entry
TUZN_2098         CDS       T01460                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TUZN_2098
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TUZN_2098
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TUZN_2098
Enzymes [BR:tuz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TUZN_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1815827..1817059
Genome map
AA seq 410 aa AA seqDB search
MDRWYNIGADLPIPLPPPKDPDDGDSRIALLTKILPSALIDQEFTAERWIPIPEEVREAY
ARMGRPTPFRRAEGFERKLGVKVHIYYKYEGALPVGSHKLNTALAQAYYAKLDGAEEVAT
ETGAGQWGMAVSLAAALFGLKATVFMTRSSYNSKRQRVTFMKAYGATVYPSPSDVTETGR
KFNKPDHPGSLGIAISEAVEYTLAGERRRYLPGSVLEFVLIHQSVIGLEAIEQMPEEPDY
AVGCVGGGSNFGGFTYPMIGMKLRGEGFEKTRFLAAESAAAPKLTSGDYRYDFPDAVGVL
PMIKMYTLGHDFVPPAVHAAGLRYHGAAPSLSVLKRLGLVEAVAYRQEEVFEAAVMFARS
EGIIPAPESSHAIRAVADLAKKLPPGSVIAFNLSGHGLLDVDAYEKAHVA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtggataggtggtacaacataggtgccgatctgcccatcccgttacctccgcctaaagat
ccagacgatggcgatagcagaatcgcgttgctcaccaaaattctgccctcggcgttgata
gaccaggagttcaccgcggagcgctggataccgataccggaggaggtcagagaggcctac
gcgcggatggggaggcccacgccgttcagaagagccgaggggttcgagaggaagctcggc
gtgaaggtccatatctactataaatacgagggggctctgccggtcggaagccacaagttg
aacacggcgctggcccaggcctactacgcgaagctggacggcgccgaggaggtagccacc
gagacaggcgcaggacagtggggcatggccgtgtcgctggcggccgccttgttcggcctc
aaggccactgtgttcatgacgaggtcttcctacaacagcaaaaggcagagggtcacattc
atgaaggcgtatggggcgaccgtctacccgagccccagcgacgtgaccgagaccgggagg
aagttcaacaagcccgaccatccgggctccctcggaatagctatctcggaggctgttgag
tacaccttggccggcgagaggaggcggtatctgccgggtagcgttctcgagttcgtcttg
atacaccagtcggtcatcggccttgaggccatcgagcaaatgcctgaggagcccgactac
gctgtcggctgtgtgggcggcggctctaacttcggaggcttcacgtatccaatgataggg
atgaagctgaggggcgagggcttcgagaagacgaggttcctggccgccgagtctgccgcc
gcgcctaagctcacgtcgggcgactaccgctacgacttcccggacgccgttggggtattg
cccatgattaagatgtacacgctcggccacgacttcgtcccgccggcggtccacgcagcg
ggcctccgctaccacggcgccgcccccagcctctcggtcctcaaaaggctgggcttggtc
gaggcggtggcctataggcaggaggaggtcttcgaggcagccgtcatgttcgcgaggtcc
gaaggtataataccggcgcccgagagctcccacgcaataagggcggtcgcagatctcgcc
aagaagttgcctccgggctccgtcatagcgttcaacctgtccggccacgggcttctggac
gtagacgcgtacgagaaggcccatgtcgcttaa

DBGET integrated database retrieval system