KEGG   Thermoproteus uzoniensis: TUZN_2145Help
Entry
TUZN_2145         CDS       T01460                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
tuz00010  Glycolysis / Gluconeogenesis
tuz00620  Pyruvate metabolism
tuz00640  Propanoate metabolism
tuz00680  Methane metabolism
tuz00720  Carbon fixation pathways in prokaryotes
tuz01100  Metabolic pathways
tuz01110  Biosynthesis of secondary metabolites
tuz01120  Microbial metabolism in diverse environments
tuz01130  Biosynthesis of antibiotics
tuz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TUZN_2145
   00620 Pyruvate metabolism
    TUZN_2145
   00640 Propanoate metabolism
    TUZN_2145
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TUZN_2145
   00680 Methane metabolism
    TUZN_2145
Enzymes [BR:tuz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TUZN_2145
Lipid biosynthesis proteins [BR:tuz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TUZN_2145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEA13602
UniProt: F2L5Q6
Position
complement(1851465..1853132)
Genome map
AA seq 555 aa AA seqDB search
MSEEIDLRKYSFSSYNELYSSFKWNIPEYFNIGYAIIDRNVERGFGDRLAIYYLDDEGNR
YSLTFGELKKLSDGLASSLRDIGVGRGDVVGVYLQPRPEVVVALSAIYRLGAIALSISPL
IGTEGVEYRLRHSGAKALIAEGARRDVLDAVSKIEHLRAIYVVGSEPRGGKEYSLEDQSR
SGRRIDAVATRSEDPAQLFYTSGSTGPPKGVLHAHRFLLGHVPTYQLYFEMAPREDDVFW
TNADWGWIGALGDVVLPSLYFGRPVVAYRRSRGFSAGDALKVMEEYGVTAAFITPTALRM
IRREYPQPLKDFGLRLRAVSTAGEAPGRELVEWASQAFRAPVNEFYGCTETNLVVTNNSL
WARPGSIGRPAPGHVVDVVDEEGRPLPPGSEGLIAVKLPDPVAFLGYWKNPEATAAKIKN
GWFIIGDAGVKDGDGYLWFKGRVDDVIKVAGYRLGPEEIEEVVAKHPAVLEAAVIGKPDP
VRGTIVKAFVVLKPGVEPSEELKRDIQNFVKSRLAAYAYPREIEFVDQLPRTETGKLKRY
ELRRREMERGNVQGG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagaaatagacttaaggaaatattctttttcttcatataatgaattatattct
agttttaaatggaatatacctgaatatttcaatataggctatgctattatagaccgtaat
gtggaaagaggattcggcgacaggctggcgatctactacctagacgacgaggggaacaga
tactcgctcaccttcggcgaattgaaaaagctgtcggacggactggcgagctccttaagg
gatataggggtcgggaggggcgacgtcgtcggcgtgtatctgcagccgcgccccgaggtc
gtggtggcgctgagcgctatctataggctgggggctatagctctctccatctcgccgctt
ataggcacggagggggtagagtaccggctgaggcacagcggcgccaaggccctgatagcc
gagggggcgaggagggacgtcctcgacgctgtcagcaagatagaacacctaagggccata
tatgtggtgggttccgagcccagaggcggcaaggagtattccctcgaggatcagtcgagg
tcgggtcggcgtatcgacgcggtcgccaccagaagcgaggatccggcccagctcttctac
acgtcgggcagtaccggtcctcctaagggcgtcctacacgcccacagattcctgctgggg
cacgtgcctacatatcagctgtacttcgaaatggctcctcgggaagacgacgtgttttgg
accaacgcagactggggctggataggcgccctcggcgacgtggtcctgccgtcgctctac
ttcgggaggcccgtcgtggcctacaggagatcccgcggattcagcgcaggcgacgccctt
aaggtcatggaggagtacggcgtaaccgccgcgttcataacaccgacagccctgaggatg
ataaggcgggagtacccgcaacccctcaaggacttcggcctaaggttgagggcggtcagc
acggcgggggaggccccggggagggaactcgtcgagtgggcgtcccaggcgtttagggcg
ccggtgaacgagttctacggatgtaccgagacgaacctggtcgttacaaacaactcgctc
tgggccaggcctggctctataggcaggccggcgcctggacacgtagtggatgtggtggac
gaagaggggcggccgctgccgccgggatccgagggcctaatagcggtcaagttgccggac
cccgtcgccttcctcggatattggaagaaccccgaggccaccgcggccaagatcaagaac
gggtggttcataataggcgacgctggggtcaaggacggcgacggctatctctggttcaag
gggagggtcgacgacgtgatcaaggtggcaggctataggctggggcccgaggagatagag
gaggtcgtggcgaagcacccggccgtccttgaagccgccgtgatagggaagccggacccc
gtccgcggcacgatagtcaaggccttcgtcgtgcttaagccgggagtcgagcccagcgag
gagctgaagagggatatccagaacttcgtgaaaagccgactcgcggcctacgcgtatccc
agagagatcgagttcgtggaccagctacctaggacggagacgggcaagctcaagcgctac
gagcttaggcgcagggagatggaaagagggaatgtacagggcggttga

DBGET integrated database retrieval system