KEGG   Thermoproteus uzoniensis: TUZN_2148Help
Entry
TUZN_2148         CDS       T01460                                 

Definition
(GenBank) Radical SAM domain protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
tuz  Thermoproteus uzoniensis
Brite
Enzymes [BR:tuz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TUZN_2148
Transfer RNA biogenesis [BR:tuz03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TUZN_2148
Chromosome and associated proteins [BR:tuz03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TUZN_2148
   HAT complexes
    Elongator complex
     TUZN_2148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_10 Acetyltransf_1 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: AEA13605
UniProt: F2L5Q9
Position
1855179..1856585
Genome map
AA seq 468 aa AA seqDB search
MELPAVRKPVRSASGVHVVALMTGPSPCPGQCVFCPTARGVPKSYMPDSPAVMRASRSRY
DPYRQVVARISNYLAGGHRPSKIEAIVMGGTFTALPRSYQFWFVGNLLKALNDYPNWSSA
SAVVDIEAEQARNETAALRLVALTVETRPDYLERGQIDDLLEMGVTRVEIGVQSIYDDVL
SLVRRGHGVKEVVEATARLKDAAYKVCYHLMPGLPGSDPDRDLEMFRTVFEDPAFKPDCV
KIYPTLVVPGTELYDWWRSGRYRTYDEETWRWLLAEIYASVPRWVRVMRLGRDIPLHHVV
DGPRWGNMREVVEEEMERRGLHCSEIRCREAGIKAVHGRPADGNIEYRRHVYEASGGLEY
FFEAVGRDDTLYGILRLRIPANPWRPEIDRRTALVRELHVYGPEVPVGADGGPWPQHKGI
GRKLMALAEEAATAEAARRVVVISGIGARPYFAKLGYKRCGPYMCKEL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtggagctccctgcggtgaggaagcccgtcaggtcggccagcggcgtccacgtggtggcc
ttaatgactgggccttcgccgtgtcccggtcagtgcgtcttctgcccgaccgccaggggg
gtccccaagtcctatatgccggattccccggccgtcatgagggcctctaggtcccgctac
gatccctacaggcaggttgtggccaggatatccaactacctggcggggggccacaggccc
agcaagatcgaggcgatagttatgggaggcaccttcactgcgttgccccgtagctaccag
ttctggttcgtgggcaacctcctcaaggcgctgaacgactaccccaattggtcctcggcc
tcggccgtagtcgacattgaggcggagcaggcgaggaacgagacggcggcgctgaggctg
gtggcgttgaccgtggagacgaggccggactatctggagagggggcagatagacgacctt
ctagagatgggcgtaacgagggtcgagataggggtccagtccatatacgacgacgtgctc
tcgttggttaggcgggggcacggcgtgaaggaggttgtcgaggcgacggccagattaaag
gacgcggcctacaaggtctgctaccacctaatgccgggcttgccggggagcgatccggat
agggacctcgagatgttccggacggtgttcgaggacccggcattcaagccggactgcgtg
aagatatacccaacccttgtggtccccggcaccgagctatacgactggtggaggtcgggc
cgttacaggacgtacgacgaggagacttggcgttggttgctggccgagatatacgcgtct
gtgccgcgctgggtgagagtcatgaggctgggcagagacatacctctacaccacgtcgtg
gacggcccgcgttggggcaacatgagggaggtcgtcgaggaggagatggagcgccgcggc
ctccattgtagcgagatcaggtgcagggaggcgggcatcaaggcggtccacggcaggccc
gccgacgggaatatagagtataggcggcacgtttacgaggccagcggaggcctggagtac
ttcttcgaggcggtgggccgcgacgacaccctatacggaatattgaggctccgcataccc
gccaatccctggaggcccgagatcgatcgccggactgctctggttagggagctacacgtc
tacggccccgaggtccctgtgggagccgacggagggccttggccgcaacataaaggtata
ggcagaaaattgatggcgttggccgaggaggcggcaaccgccgaggcggcgaggcgcgtg
gtcgtgatatcggggatcggggcgaggccctacttcgcgaagctgggatataagaggtgc
gggccctatatgtgtaaggagctctag

DBGET integrated database retrieval system