KEGG   Thermoproteus uzoniensis: TUZN_2154Help
Entry
TUZN_2154         CDS       T01460                                 

Definition
alpha-amylase
Orthology
K07405  
alpha-amylase [EC:3.2.1.1]
Organism
tuz  Thermoproteus uzoniensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tuz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TUZN_2154
Enzymes [BR:tuz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     TUZN_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1861722..1863089)
Genome map
AA seq 455 aa AA seqDB search
MDVVLFFEVHQPYRLRPDLYKVFPRIPSFREMFYPELDSAIFSRVAERVYRKATEIVLEA
AKEVGFRATFSISGLALEQMREKAPDVLELFRELASRGFEFVAQTYYHSLAWFVDVEEFE
EQVKMQAKAVEELIGYRPAAAENTEFMYNNDIACRLGQMGFRTVITEGADWVLSWRSPNY
VYRAWGCDVRVLTRNYRLSDDVGFRFGARWWDQWPLTADKYASWLEAVQGDLVLIAVDYE
TFGEHHWPESGIHEFLRWLPREIARRPRLRFATVSEAAARHAPRDVFDVPPWATISWADE
RDLSAWLGNELQRNAFATLKWLYPYAKAIGGDVLRLWRLLSTSDHFYYQATKLGPAGEVH
SYFSPYGSAYKAHDIYMNALAALTALIRESWRAEHAERLRLNDERCFYAGGVRLCSLKEL
RSADRNFKERYRDDLRRWLLDVFMLNEREADAALS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggacgtggtgttgtttttcgaggtgcaccagccctacaggctgaggcccgacctatac
aaggtctttccccgaatcccgtcgttccgggaaatgttctaccccgagctggactcggcc
atattctcgcgggtggccgagcgcgtctacagaaaggccaccgaaatagtcttggaggcc
gccaaggaggtcggttttagggcaaccttcagcataagcggcctggcgctggagcagatg
cgcgagaaggcgccggacgtcctggagctcttccgcgagctggcgtcgagaggcttcgag
ttcgtcgcccagacctattaccacagcttggcttggttcgtcgacgtcgaggagttcgag
gagcaggtcaagatgcaggcaaaggccgtagaggagttgataggctataggccggccgcc
gccgagaacaccgagttcatgtacaacaacgacatagcttgccgcctgggccagatgggg
tttaggactgtaatcaccgagggcgccgactgggtcttgagctggagatcgcccaactac
gtctatagggcctgggggtgcgacgtccgcgtcctcacgaggaactacaggctgagcgac
gacgtgggcttcagattcggcgcgcggtggtgggatcaatggcccttgacggcggacaag
tacgcctcgtggctcgaggcagtccagggagatctcgtgctcatagcggtcgactacgag
actttcggcgaacaccactggcctgagtcgggcatccacgagttcctgcggtggctcccg
cgggagatcgcgcggaggccgaggttgaggttcgccaccgtgtcggaggccgccgcgagg
cacgcgcctagggacgtcttcgacgtccctccctgggccacaataagctgggccgacgag
agggacctctcggcgtggctgggcaacgaactgcaacgcaacgccttcgctacgctcaag
tggctgtacccctacgccaaggccataggcggggacgtcttgcggctgtggaggctcctc
tcgacaagcgaccacttctattatcaagcgaccaagctggggccggccggcgaggtccat
tcctatttcagcccctacggctccgcctataaggcgcacgacatatacatgaacgcctta
gcggctttgaccgcgcttatcagagagtcctggcgcgctgaacacgccgaacggttaagg
ctcaacgacgagaggtgcttctacgcgggcggcgttaggctctgctcgcttaaggagctc
aggtcggccgaccgcaacttcaaggagaggtatagggacgacctccgcagatggctactc
gacgtgtttatgctgaacgagcgcgaggccgacgccgcgctttcataa

DBGET integrated database retrieval system