KEGG   Trichomonas vaginalis: TVAG_003360Help
Entry
TVAG_003360       CDS       T01022                                 

Definition
CMGC family protein kinase
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     TVAG_003360
Protein kinases [BR:tva01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   TVAG_003360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MYSFAEFQYKNKPSYISINSPSHGKHVKPPVPKLAFENLKCDENQPVNSARVYGPKAPAG
PNPRFSHAPRTARKPAMSPIIPNAPISPEEAKSKYASMLTSYEMNEIKDFPEIYYLGIPS
KKVQVKSTPGSNNYGFDDSNYHYKAIVGDHLAYRFEIRAIFGKGAFGQVLRCYDHKTKQQ
VAIKLVINTEQMHEQGKIEVMIVQHLNKYNPDKNSDIVRTFDAFIWRQHIAVSFEILGMN
LYEYSRSIRFQPMSLQQIHSIAKHMLNGLAFCHKHNVVHCDMKPENVLLLPNSTMKCRVI
DFGSSCFDGHQKYEYIQSRYYRAPEVILGIKYGPPMDIWSFACIVVEMMIGRPLFPGDNE
HEQLEMIMEVFGVPPVSVINQCKRKAEFFTPDNKPLLRNRRKKLRMPGQSNLRAATKFSD
PVFLDFLQKCFEWDQDKRITAEQALNHQWFSVVKTVKANTRSNSARPNSGKSLPGINTRN
RYY
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtattcttttgctgaattccaatataaaaacaagccatcttatatcagtattaactcc
ccatcccatgggaaacatgttaaaccaccagttccaaagttagcttttgaaaatcttaaa
tgtgatgagaatcaaccagtaaattctgcaagagtttatggtccaaaggctccagcaggt
ccaaatccaagattttcgcatgctcctcgcacagcgagaaagcccgccatgtcaccaatc
atcccaaacgcaccaatttcacctgaagaagcaaaatccaagtatgcttcaatgcttact
tcctatgagatgaatgaaatcaaagacttccctgagatttattatctcggaattccttcg
aagaaagttcaagtcaaatcaacaccaggctcgaataactacggttttgatgattctaat
tatcattacaaggcaattgtaggtgatcatttagcatatcgctttgaaatccgtgctatt
ttcggaaaaggtgcatttggacaagttcttcgctgctacgatcataagacaaagcaacaa
gttgcaatcaagcttgttattaatactgaacaaatgcatgaacaaggtaaaatcgaagtt
atgattgttcagcatttgaataagtacaatccagataagaacagtgatattgtacgaaca
tttgatgcattcatttggagacaacacattgctgtttcattcgagattcttggaatgaat
ctttacgaatacagtcgctcaattcgtttccagccgatgtctttgcaacaaatccactca
attgcaaagcatatgctcaacggtcttgctttctgccataagcacaacgttgttcattgt
gatatgaagcctgaaaacgttttacttcttccaaactccacaatgaaatgtagagtcatc
gattttggatcatcatgttttgatggacatcaaaaatatgaatacatccaaagtcgttac
tatcgcgctccagaagttattcttggaatcaaatacggacctcctatggacatctggtct
tttgcttgcattgttgttgaaatgatgattggaagaccactattcccaggtgataatgaa
catgaacagcttgaaatgatcatggaagttttcggagttcctccagtctctgtcatcaat
caatgcaagaggaaagcagaatttttcactccagacaacaagccattattaagaaacaga
aggaagaaactcagaatgccaggccaatcaaacttgagagctgccacaaagttctcagac
cctgttttccttgatttcttgcagaaatgttttgaatgggatcaggataagagaatcaca
gctgagcaagcattgaaccatcaatggttcagtgttgtaaaaacagtcaaggccaataca
aggtcgaactcagctagaccaaattctggaaaatctcttccaggtattaatactagaaac
agatattattag

DBGET integrated database retrieval system