KEGG   Trichomonas vaginalis: TVAG_005950Help
Entry
TVAG_005950       CDS       T01022                                 

Definition
AMP-binding enzyme family protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVAG_005950
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_005950
   00620 Pyruvate metabolism
    TVAG_005950
   00640 Propanoate metabolism
    TVAG_005950
Enzymes [BR:tva01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TVAG_005950
Lipid biosynthesis proteins [BR:tva01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TVAG_005950
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 649 aa AA seqDB search
MNYQAFNAETYKKMEKEAIENPTKFWSETAKDILKWESTDFKNIIGKIGDEKSCWFEGGK
INTCYNAVDRHAMAHPDKVALLYEGNDIDDSRQMTYGELLQNVCKMANVLKSKGVTKGSH
VAIYFPVSIEGIVSMLACARIGAIHTVIFGAFSGDALSYRIHNSDATVVISQESYKRAAK
AIPMKTTLLNALKSCPNIKNVIISGLTEKPTEKLPYEVESYQELMAAASDKCDCEIMDGS
DPLFILYTSGSTGEPKGIIHRVGGYTVATTLTFKYVFDTNEKSIFGCTSDIGWITGHSYV
CYGPLLNGSTTLIFGGLPLWPDATRSWQLIQKLKLTHFYTSPSAARAIAAKIKSVDQVSQ
FDISSLRVIGSVGETLDEDTCIYMRTVLGRDKCWLVDTYWQTELGSIIATSVPGIENLPP
GIVGRPLFGTEIVLAEPNGQIISTTRNPHPEIVHNGILCIATPWPGLANAAFKSTRSFKD
RYIMQGTEFFLAGDTAQIDTKGNIRITGRIDDQLCVNGHRVGPAEVEEAILKVDGVEDVA
VIGVPSKKTTQAIIAFVVSADNSQEMVTKVAVKVTQNFGAIGRPQKVIFVKMLPKTNSAK
IIRSYLRELFLNVDNNKSVPKPTACTMTQEEIGELIDIIKETQTDLASL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaattatcaagcttttaatgccgaaacttataaaaagatggagaaggaagccatcgaa
aacccaacaaagttctggtctgaaacagcaaaggatattttaaagtgggaaagtacagat
ttcaagaacattatcggaaaaattggtgatgaaaagtcttgttggtttgaaggaggtaag
attaatacatgttacaatgccgtcgatcgtcatgcaatggctcatccagataaggtcgct
ttattatacgaaggaaatgatatcgatgattcaagacagatgacttatggcgaactctta
cagaatgtttgcaagatggcaaatgttctcaaatcaaagggagttacgaaaggatcgcat
gtagctatctatttccctgtctcaatcgaaggaattgtatcaatgttagcttgcgctaga
attggtgcaatccatacagtcattttcggagccttttctggtgatgctctctcttacaga
attcataattctgatgctacagttgttattagccaagagtcatacaagcgtgctgcaaag
gctatcccaatgaaaacaacgctattaaatgctctcaaatcctgccctaacatcaaaaac
gtaatcatcagtggtttgacagaaaagcctacagaaaaacttccatacgaagtagaatca
taccaagaacttatggctgctgccagcgataagtgcgattgcgaaattatggatggttct
gacccattattcattttatacacatctggctcaacaggtgagccaaaaggtattatccac
agagttggtggttatacagtcgctacaacacttacattcaaatacgtatttgatacaaat
gaaaaatcaattttcggctgtacctcagatatcggctggattacaggccattcatacgtc
tgttacggacctctcctcaatggttccacaactcttatctttggaggacttcctctttgg
ccagatgcgacaagatcatggcagcttatccagaagctcaaattgacacacttctacaca
tccccatcagccgcacgtgccattgctgctaaaatcaagtccgttgaccaagtttcacag
ttcgatatttcttcattacgcgttatcggatcagttggtgagactctcgatgaagatacc
tgcatctacatgcgcactgtcctcggaagagacaaatgctggctcgtagatacatattgg
cagacagaattaggttctatcattgctacatcagttccaggcatcgagaatcttcctcct
ggtatcgttggccgaccacttttcggtacagaaattgttcttgccgagccaaacggtcaa
attatctcaacaacaaggaatccacacccagagatagtccacaacggcatactttgcatt
gccacaccatggccaggtcttgcaaatgctgccttcaagagtactcgctctttcaaggac
agatatattatgcaaggcacagaattcttcttagcaggcgatacagcgcagattgacaca
aagggcaacatcaggatcactggtagaatcgatgaccagctttgcgtcaatggccacaga
gttggtccagcagaagttgaagaagcaatcttgaaagtcgatggagttgaagatgtcgct
gtcatcggtgtaccatcaaagaagacaacacaggcaatcattgctttcgttgtatctgct
gacaattcacaggaaatggtcacaaaggtcgctgtcaaagtcacacagaactttggagca
attggtagaccacaaaaagtcattttcgtgaagatgcttccgaagacaaacagtgcaaag
attatcagatcgtacttaagagaactcttcttgaatgtcgacaacaataagagcgttcca
aagccaactgcttgcacaatgacacaagaagaaatcggagagctcattgatattatcaag
gaaacacaaacagatcttgcatctctttaa

DBGET integrated database retrieval system