KEGG   Trichomonas vaginalis: TVAG_005990Help
Entry
TVAG_005990       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
tva  Trichomonas vaginalis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TVAG_005990
   03420 Nucleotide excision repair
    TVAG_005990
   03430 Mismatch repair
    TVAG_005990
   03440 Homologous recombination
    TVAG_005990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MSITSQPENDHVSSERTYEIVRTNVNIIPVTIKQILNAEVKDNAFMINGVQAKVIRIIGK
ILSHEEQDATTDKYVLNDCSGTIEAFESVDPSNVREPFEDNRYVAITGMLKFENDSKSLS
IESIEYADDYNRITYHALDTIHAHLYFTKGGFPQNTIYTAQNREPYQPNTAHADTKAASE
GDIDQGILSCMKSHGEGAQVTKSEIISALKDKFSVVQIEGRISKLNEDGLIYQADEDTYS
IA
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagtataacttcacagccagaaaatgatcatgtctcttcagagagaacatatgaaata
gtaaggaccaatgttaacatcattcctgtgacaatcaagcaaattctcaatgctgaagtc
aaggataacgcttttatgatcaatggagttcaagccaaagttatcagaatcattggtaag
atcctttctcatgaagaacaagacgctacaacagataaatacgtattaaacgattgctca
ggtacaattgaagcattcgaaagtgttgatccatcaaatgttagagaaccatttgaagat
aacagatatgtagccattactggtatgttaaaatttgaaaatgattccaaatccttatca
attgaatcaatcgaatacgctgatgattacaataggataacatatcatgcacttgataca
attcatgctcatttatactttacaaaaggtggattcccacagaatactatatatacagct
caaaatagagaaccataccagccaaatactgctcatgctgacacaaaggcagcatctgaa
ggtgatatagatcaaggaatcctttcatgcatgaaatcccatggtgaaggtgctcaagtt
acgaaatcagaaatcatcagtgcacttaaggataagttctcggttgttcagatcgaagga
cgcatttccaagctcaatgaagatggtcttatataccaagctgatgaagatacatattca
attgcataa

DBGET integrated database retrieval system