KEGG   Trichomonas vaginalis: TVAG_008800Help
Entry
TVAG_008800       CDS       T01022                                 

Definition
CMGC family protein kinase
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 356 aa AA seqDB search
MDRPPITEDLVNKETQGRYKFVKTLGRGAYGVVFAAIEKATGKEVAVKHVDRVFESPLDA
KRCLREVKILSQLNHENITNLVDISCLPDYENFKGLAIVMDLMDTDMCQIINSGQPLLVE
HHRYFIYQLLRGLKYLHSANILHRDLKPSNLLLNSDCDLKIADFGLARISEPDEPQEFLS
EYVATRWYRAPEVLLNYDTYGAPMDMWSVGCITAELVLRHPLFRGTSTRNQLELITQILG
SPTDKDLEGCTNQKAYRFMQQLPPQTKVPWEELFQGKTYNPEEIDFIDRLLKWNPNERMT
VEEALEHPFVVKLHDPFDEPVGFPFEEFDFERQDVTVEELKMEMWKEILKRHPKFE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggatagacccccaattacggaggatcttgttaataaagagactcaaggccgctacaaa
ttcgttaagacactcggtcgcggtgcttatggcgttgtttttgccgccatagaaaaagca
acaggcaaagaagttgctgtcaaacatgttgatcgtgtttttgaatcacctcttgatgcc
aaacgctgcttgcgtgaagtcaaaatattatcacaacttaatcatgaaaatattacaaat
cttgttgatatctcttgcttacctgattacgaaaacttcaaaggattagctatcgtgatg
gatttaatggatacagatatgtgtcaaattattaatagtggacaaccactccttgtagaa
caccacagatattttatttaccagttacttcgtggacttaaatatcttcactccgcaaac
attcttcaccgtgatttaaagccatccaacttacttttgaactcagattgcgatctaaaa
attgcagattttggtcttgcacgtatttccgaaccagatgaaccacaagagttcctttca
gaatatgtcgctacccgatggtaccgtgctccagaagttcttcttaattacgatacatac
ggtgctccaatggatatgtggagcgttggctgcattacagcagagcttgttcttcgccat
ccacttttccgtggaacttccactcgtaaccagttagaacttattacacagattcttggt
tctccaacagacaaagacctcgagggatgcacaaaccagaaagcctacagatttatgcag
caacttcctccgcagacaaaggttccatgggaggagttattccaaggaaaaacatataat
ccagaagaaatcgactttattgacagactcctcaagtggaatccgaacgaaagaatgaca
gttgaagaggccttggagcacccattcgtcgtcaaacttcacgatcctttcgatgaacca
gttggcttcccattcgaggaattcgacttcgaaagacaagatgttactgttgaagagctc
aaaatggaaatgtggaaagagatattgaagcgccatccaaaattcgagtaa

DBGET integrated database retrieval system