KEGG   Trichomonas vaginalis: TVAG_010970Help
Entry
TVAG_010970       CDS       T01022                                 

Definition
Thioredoxin family protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tva  Trichomonas vaginalis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TVAG_010970
Enzymes [BR:tva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TVAG_010970
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TVAG_010970
  Exosomal proteins of colorectal cancer cells
   TVAG_010970
  Exosomal proteins of bladder cancer cells
   TVAG_010970
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 429 aa AA seqDB search
MKEKPIGVTIFHDTVANNIWANFGLEKYKNNISFARSGHEDGAKYGCLYYPCCVAFQNGK
KMDIPPPLARSSSFFLWLGELLEGPIKHLKSKEQLRVALEEHGQTVFGIDLEEPPRHLGK
LQYYSVNSSLFAKFNISLQKGYYIYDNIERRIEKFEGKPLKTLLTDPRAVDISSKPFYGG
FVVNTKLDKVSEMQIDLLKKLAEKYGDKFQFGPIVGTNALLFLKAGRIEGLDAPYFVAFK
TSNLTEGRWLLYRETDNIMDLPTLEKFVQDIMAGKLPYTIISEPIPEDANNNLKHIVGST
FSDVVFEDGYDTLVAFTSSWCKLCPRLLIVLRELAELTKDTKARICFMDGSENDTPMSVP
EFSSYPTLMLFPSGHKADKPLVYKGTYRVKDLSEFIANRGTTGFKLTQDVDFDALEEKIT
DEFHKNKQL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaccaattggtgttacaatattccatgatacagtggcaaataatatctgg
gccaacttcggtttagagaaatacaaaaacaatatctcatttgcacgcagtggacatgaa
gatggagccaaatacggctgcttatattatccatgctgtgtagcctttcaaaatggaaag
aaaatggacataccaccaccacttgctcgctcttccagcttcttcttatggctcggcgaa
cttctagagggtccaattaaacatctgaaatccaaagaacaattaagagtagctcttgag
gagcacggacaaaccgtatttggaattgatttagaggagccaccaaggcatctcggaaaa
cttcagtattattcagtcaattcatccttatttgccaaattcaacatctctcttcagaaa
ggatactacatctacgataacattgagcgtagaatcgagaaattcgaaggaaaaccactc
aaaacattacttacagatccacgtgctgttgatatctcctctaagccattttacggtggt
ttcgtcgttaatacaaagcttgataaagtctctgagatgcaaattgatctccttaagaaa
cttgcagagaaatatggcgataaattccaatttggtccaattgttggcacaaacgccctc
ttattccttaaggcaggtcgtattgaaggccttgacgccccatacttcgtcgctttcaag
acatctaatttaacagaaggcagatggcttctttatcgcgaaaccgacaatatcatggat
cttccaaccctcgagaagttcgtacaagacataatggccggaaaattaccatatacaatc
atttccgagccaattccagaagatgccaacaataatctcaagcatatcgttggcagcaca
ttctctgatgttgtattcgaggatggatacgatacccttgttgctttcacctcttcttgg
tgcaaactctgtccacgtcttttaattgtccttagagaactcgcagaactcacaaaggac
acaaaggctagaatatgcttcatggatggctcagaaaacgatacaccaatgtctgtccct
gagttttcttcttatccaactcttatgctcttcccatcgggacataaagctgataagcca
ttagtctacaaaggaacttacagagttaaggacctctcagagttcattgctaaccgtgga
acaactggattcaaattaacacaagatgttgatttcgatgcactcgaagagaagatcaca
gacgaattccataagaacaagcaactttaa

DBGET integrated database retrieval system