KEGG   Trichomonas vaginalis: TVAG_019670Help
Entry
TVAG_019670       CDS       T01022                                 

Definition
Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
tva  Trichomonas vaginalis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tva00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TVAG_019670
Enzymes [BR:tva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TVAG_019670
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_019670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 583 aa AA seqDB search
MKAQSFFKQFRDKKSRLIDIPAETKGRKVCLVDYDWYKSLEKWLNEKTPQPPGKINNKGL
LLGDTLNPRMQRKIDYEIIEEDMWLLVTQVFGNTQKIERYYVIEPESKKPYVILDYVNLH
IKVDNLREVKKMSDKKWKVGPIIKQLCETLKINYNDYKIMTPDQSETINPDTKIQQIDEK
YKGIIQIVRKNQPKNINLQNFEQVAEPAKKQEITKYEITKPPEIIQKSSFNNTTQQISTP
KPEPVVEKPIDDIPLTKYSISAVGFVNLGNTCYFNASLQCLFHIQRLTDIILSPSFLSRI
NTTNKKGSGGRVAMAYRSTLMSLCNAKDYSVLTPTDIRAAFTSRFRKYANNNEHDAQEAM
LDMLDALHEDTNEHAGLEIPKNLTDHWQIHLSQNNSPIVDLFHGELVSSIHCPSCGKDES
VHEPFTFLSVPIRSQIFSSVSLEECINEFAERDVLDASNKWECPFCKEHVEAVKELAVFR
CPSILLIQLKRFNPVTKAAITTNITYPDTLDMRGFVKGPDPGNFKLIGAVFYHKSVFMEH
YTSACLSMANNKWYSFDDNIVKEIDQTSAHQGNAYILIYQKRE
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcaaagcttttttaaacagtttagagacaaaaaaagcagactaattgatatc
ccagcagaaaccaaagggagaaaagtctgtcttgttgattatgactggtataaatcactt
gaaaaatggctgaatgaaaaaactccacaacctccaggcaaaatcaataataaaggactt
ttgcttggcgacacattaaatcctagaatgcaacgcaagattgattatgaaattatcgag
gaagatatgtggctactagtaacacaagtatttgggaatacacagaagattgaaagatac
tatgtaattgaacccgaatcgaaaaagccatatgttattcttgattacgtaaatttacat
ataaaagttgataatcttagagaagtcaagaaaatgtctgataaaaaatggaaggttgga
ccaattataaaacaattatgcgaaacattaaaaataaattacaatgattacaaaattatg
acgccagatcaatcagaaacaataaatcctgatacaaaaatacaacagattgacgaaaag
tacaaaggaattattcagattgtccgtaaaaatcaaccaaagaatataaatttacaaaac
tttgaacaagtggccgaaccagctaaaaaacaagaaataacaaagtacgaaattacgaaa
ccaccagaaattattcaaaaatcttcattcaataatacaactcagcaaatatcgactcct
aagccagaaccagttgtagaaaagcctattgacgatatacctcttacaaaatacagtatt
tcggccgttggttttgtaaatttaggaaatacgtgttatttcaacgcaagtcttcaatgt
ttgttccatatacagcgacttacagatatcatactttctccttcattcctttctcgcata
aatacgacaaataagaaaggatctggaggaagagtcgcaatggcgtatagatctacatta
atgtcactctgcaatgcaaaggattattctgtattgactcctacagatattagagctgct
tttacgtcaagatttcgtaaatatgcaaataataatgaacatgacgcccaagaagccatg
ttagacatgcttgacgcccttcacgaggacacaaatgaacacgccggactcgaaattccc
aaaaatttgacagaccactggcaaattcacttatctcaaaataattcaccgattgttgac
ctgtttcatggtgaattagtatcatcaatacattgtccgtcatgtgggaaagatgaatcc
gttcatgaaccatttacattcctttctgttcctattcgttcccaaattttttcttcagtt
tcactggaagagtgcataaatgagtttgctgaacgagatgttctagatgcaagcaataaa
tgggaatgccctttctgtaaggagcatgtagaggccgtaaaagagctcgcagtgttcaga
tgtccttcaattttactgattcagctcaaaagattcaatcctgtaacgaaagctgctatt
acaactaatattacgtatccagataccttagatatgagaggattcgtcaaaggaccagat
ccaggaaatttcaaattaattggagctgttttttaccataaatctgttttcatggagcat
tatacgtccgcctgtctctccatggccaacaataaatggtacagcttcgatgacaacatt
gtaaaagagatcgaccaaacttctgctcatcagggaaacgcttacatcctaatttatcag
aaaagagaatag

DBGET integrated database retrieval system