KEGG   Trichomonas vaginalis: TVAG_021740Help
Entry
TVAG_021740       CDS       T01022                                 

Definition
EF hand family protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 190 aa AA seqDB search
MGINVSAVYHGYLGEEEAQMFVQKSYFTLKQIYILSQKYRQMSKDSRINLNDFEVAMNIP
NHQIAEILFKIIDDDGSGEITFPEFVEGLNKFHPDAPFDEKVKLCFQAYDADGSGNVSAD
EIRNIIQISLKNNQYLDFTESQIDELVSQLIDTYSRDKKELTFQEFYNMVSKATGVIEAF
DIDTDQLVEQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcaacgttagtgctgtttatcatggttatcttggagaagaagaggcacagatg
ttcgttcagaaatcttatttcacattgaagcaaatttatattctatcccagaagtaccgc
caaatgtcaaaagattcaagaattaacttaaatgattttgaagttgcaatgaatatacca
aatcatcaaattgcagaaatcttgttcaagattattgatgatgatggtagtggcgaaata
acgtttcctgaattcgttgaaggattaaacaaattccatccagacgcaccgtttgatgaa
aaagttaaattatgtttccaggcttacgatgcggatggcagtggcaacgtttccgctgat
gaaatacgaaatattatacaaatttcactcaaaaacaaccaatatcttgatttcaccgag
tctcagatagatgaacttgtttcacaacttattgacacatattcgagagacaagaaggaa
ctcacttttcaagaattttacaacatggtatctaaagcaactggtgtcattgaagcattc
gatatcgacactgatcaattagttgaacagtaa

DBGET integrated database retrieval system