KEGG   Trichomonas vaginalis: TVAG_025610Help
Entry
TVAG_025610       CDS       T01022                                 

Definition
(RefSeq) Clan CA, family C19, ubiquitin hydrolase-like cysteine peptidase
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     TVAG_025610
Peptidases [BR:tva01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   TVAG_025610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 813 aa AA seqDB search
MSIPTKEEQAERLKNLERTSSISVEDGAYIISAKWMINYKAAIGFNQFDPANVEVGPIDN
SEIADPENKSRVAKTKGENTDFYIVDKTEWDVLYGWYGCNNIIKLEVVMDEVENKPISIV
YYQKLTVVYGEEKKDIEVHKYMYAKDILAKARELFNIPADKQLQLIDYLNGNYVALMDED
SYLKRYNLIDGQLIAVNYKDENDEWKIKKPTQVEYLTKLAMGSTPTTAASTTMRSRYGYD
EGKPGRHGFNNLGNTCYFNSGTQCLMHTMPLIQYFVDGRWEQWINRENKLGSHGCLATAF
NSICQQMWSDNTSGAIRPSELKAAIGGFNSRFSGYEQHDSHELILFMLDGIHEDLNRCKV
KPQVEPVIGDGANDEAIADESWKRCKLRNDSIIVDHFYGLLRSQLLCPNCQKTTVVFDPF
LTVELPLARENERKIHVSFIPKDIKAKWTEFNINIRTSEIANVNLISKLVSEKLGKEVLC
IPAALNTENFSIKFGFPDTYESRLQAVVFEIDSQDKFYVPVLIVGSVASQYNPNYFNAQP
ITPPFLIEVDDLSLEEDKYKDIVLERLKPVLDTKSEIELTEDAKNFLARIKKEPEEGQEA
PEFAVNFQKDYWKNVQSPKPSKHVKCASANGVVVTADISKLDMNVLVQNVPSNAYGYSSK
HTSTDTIPLDRCFNLFSTVDTLDEQNQWHCPHCGQFVCADKKMEIWRCPEVLVIHLKRFS
GEGYYVKKDSTLVDFPEELDMAPYIRGKTDQSTHYKLYAVSEHMGSMGGGHYIAHAIVNG
KWYKFDDSSCYESSYEDAKSPLAYVLFYQRIDK
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcccgaccaaggaagagcaagcagaaaggcttaagaatctcgaacgtacaagc
agcatttccgttgaggatggagcatacatcatatccgctaaatggatgatcaattacaaa
gctgcgatcggatttaatcagttcgacccagcaaacgtcgaagttggtcctatcgataac
tctgagatagcagacccagaaaacaaatcccgcgttgccaaaacgaagggagaaaacact
gatttttatatcgtcgataaaacagaatgggatgtcctttacggctggtacggctgcaat
aacatcattaaacttgaagttgtaatggatgaagtcgaaaataagccaatttctattgtc
tattaccagaaattgactgttgtttatggtgaagagaaaaaggatattgaagtccataaa
tacatgtatgccaaggatatacttgccaaggcacgagaacttttcaatatccctgctgat
aaacagcttcaactcatcgattacttaaatggcaactacgtggcattaatggatgaagat
tcatatctcaagcgttacaacctcatcgatggccagcttattgctgtcaactacaaagac
gaaaacgacgaatggaagattaaaaaaccaactcaagtagaatacctcacaaagcttgcc
atgggctctacaccaacaacagcagcttccactacaatgagaagtcgctacggttacgac
gaaggcaaaccaggccgtcatggctttaataacctcggcaatacatgctacttcaacagt
ggtacgcaatgtctcatgcacaccatgccgcttatccagtatttcgtcgatggccgctgg
gaacaatggataaaccgagaaaacaaattaggatctcatggctgccttgccacagcattc
aactccatttgccagcagatgtggagcgataatacaagcggcgcgatccgtccaagcgaa
ctcaaggccgcaattggaggttttaattctcgattttccggttacgaacagcacgacagc
cacgagcttattctcttcatgctcgacggcatccacgaagacttgaaccgctgcaaagta
aagccacaagtcgagccagtcataggagatggagcaaatgacgaagccatcgcagacgag
tcgtggaagaggtgcaagctccgtaacgattcaattattgtcgaccatttctacggatta
cttcgttctcaactactttgcccgaattgtcaaaaaacaactgtcgttttcgatccattc
ttaacagtcgaactacctctcgcaagggagaacgagcgtaaaatacacgtcagcttcatt
ccaaaggacataaaggccaagtggacagaatttaacataaatattcgcacatcagaaatc
gcaaacgtcaatctcatctccaaacttgtttctgagaagctcggcaaggaagttctctgc
attccagccgctttgaacacagaaaacttctcaatcaagtttggcttcccagatacatac
gaatcgagattacaagctgttgttttcgagatagactctcaagacaagttctacgttcca
gtattgatcgtaggaagtgttgcatctcaatacaaccctaactacttcaatgctcagcca
attacaccaccattcttaatcgaagtcgacgatctatctctcgaagaagacaaatacaag
gatatcgttctcgaaagactcaaaccagtattagatacgaaatctgagatagaacttaca
gaagatgcaaagaacttcttggccagaatcaagaaagagcctgaggaaggtcaggaagct
ccagaattcgcagttaacttccaaaaagattattggaagaatgttcagtctccaaagcca
tcaaaacacgtcaaatgtgcatcagcaaacggtgttgttgtcaccgctgatatttctaag
ctcgatatgaacgttctcgtacaaaatgttccatcaaacgcttacggctactcttctaaa
catacttcgacagatacgatacctcttgacaggtgcttcaaccttttcagtacggttgat
acacttgacgagcagaatcagtggcattgtcctcattgcggccaatttgtctgcgctgac
aagaagatggagatctggcgctgcccagaagtacttgtcatccacttgaagaggttctcc
ggagagggatactacgtaaagaaggattcgacacttgttgacttccccgaggaacttgac
atggctccttacataagaggaaagaccgaccaatcaactcattacaaactttacgctgtt
tctgaacacatgggatcaatgggaggaggacactacattgcacacgcaattgtcaatgga
aagtggtacaagtttgatgactcatcttgctacgaatcttcttacgaagacgctaagtct
cctcttgcttacgttctcttctatcagagaattgacaaataa

DBGET integrated database retrieval system