KEGG   Trichomonas vaginalis: TVAG_028740Help
Entry
TVAG_028740       CDS       T01022                                 

Definition
elongation protein 3 homolog
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVAG_028740
Transfer RNA biogenesis [BR:tva03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    TVAG_028740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 537 aa AA seqDB search
MSEDPNNLKAAAELAQYLINSYEKGYQPDLQREKFKIARKYHLSRGLGSSEIIKAIPLEY
RERILPLIRKKPVRTASGVAVIAFMCKPHRCPHVETNGYPCSYCPGGPDSDFDYSSQSYT
GYEPTSMRAIRSKYDPFSQIRGRIAQLNSIGHSAVKLELILMGGTFLSLEKEYRDNFIIG
MYAGVTGHVAHSVKEATTYAECSTDRAVALTIETRPDYCFAEHIDDMLTYGTTRVEIGLQ
TVWEDVLWYVGRGHGGDDVARSFRDCRRSGLKVTAHMMPNLPHTDFERDIDGFVELFENP
YWRPDGLKLYPTLVMRGTMLYDQWVDKTYVPLDPDELITLISEILRLVPPWVRVFRIQRD
VPMTLVSAGVENGNLRDIAMKRLLQRGGRARDVRAREVGITEIRDKIKPDKVELVRRDFM
ADDGWETVLSYEDTDNDILIGLVRLRAPGDTFRDELQGASLVRELHVYGQVVPIDQKDLS
RYQHKGYGAQLMAEAERITVEEHGSKRLAVISGIGVRDYYKKLGYRLEGAYMVKDFE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaggatccaaacaaccttaaggcggccgcggagctcgcccagtatctcattaat
tcctatgaaaagggatatcagccagacttacaacgcgagaaattcaaaatcgcacgtaaa
tatcacttaagtcgaggtctcggatcatcagaaatcatcaaagctattccactcgaatac
cgtgagcgtatccttccactcatcagaaagaaaccagttcgtacagcatcaggcgtcgct
gttattgcattcatgtgcaagccacatagatgcccacacgtcgaaacaaacggatatcca
tgttcatactgtccaggtggcccagactctgactttgattactcatcacagtcgtataca
ggttatgaaccaacatcaatgcgtgccattcgttccaagtacgatccattctcacagatc
agaggcagaatcgcccagttgaacagtattggacactctgctgtcaaactcgagctcatt
ttgatgggtggtactttcctttctcttgaaaaggaatatcgtgacaacttcatcatcgga
atgtacgctggtgttacaggtcacgtagcccactctgttaaggaagcaacaacatatgct
gaatgctcaacagatagagccgtcgcactcacaattgagacacgtcctgactactgtttc
gctgaacatatcgatgacatgcttacttacggtacaacaagagttgaaatcggtttacaa
actgtctgggaagatgttctttggtatgtcggcagaggacacggtggcgacgatgttgct
cgttccttcagagattgccgtcgttccggactcaaagttacggctcatatgatgccaaat
cttccacatacagatttcgaacgcgatatcgatggtttcgttgaattattcgaaaaccca
tactggcgtccagacggactcaagctctacccaactctcgttatgagaggaacaatgtta
tacgatcaatgggttgacaagacatacgttccattagatccagacgagttaattacattg
atctcagagatcctccgccttgttccaccatgggtcagagttttccgtatccaaagagat
gtcccaatgacattagtttccgccggtgtcgagaacggcaacttgagagacatcgccatg
aagagattgctccagagaggcggtcgtgcaagagatgtccgcgcaagagaggtcggcatt
accgaaatcagagacaaaatcaagccagacaaggtcgaattggtcagaagagacttcatg
gccgacgatggctgggaaacagttctctcatacgaagacacagacaacgacatcctcatt
ggccttgtaagactcagagcaccaggagacacattcagagatgagttacaaggagcttct
ttggtcagagaattacacgtgtacggacaggttgttcctatcgaccaaaaggacctttcc
aggtaccagcacaaaggatacggagctcagttgatggcagaagcagagagaatcactgtt
gaagagcacggatcaaagagactcgctgttatttctggtatcggtgtcagagattactac
aagaagctcggatacagattggaaggcgcttacatggtcaaggatttcgaataa

DBGET integrated database retrieval system