KEGG   Trichomonas vaginalis: TVAG_047190Help
Entry
TVAG_047190       CDS       T01022                                 

Definition
glycosyl hydrolase
Orthology
K05546  
alpha 1,3-glucosidase [EC:3.2.1.84]
Organism
tva  Trichomonas vaginalis
Pathway
N-Glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:tva00510]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tva04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 824 aa AA seqDB search
MFGILLRISYSAIRTCEDLDFCAENIGKSQTWAIDKSTIIANDSVYFTMQNEEKKSKISF
QISYIANVGFRFRANPIPADNFFRYDLSNESLVIDQDTIKNLEVLKSEIGDKIILKRDSM
ALTVEFEPFNIYIENNGERIITINGEQSLLFQHHMEVEEPDKWESFTDLIPNGPTAVACD
FKFEKEGVHFSGLGERSAPLNIENQQEPIRLYNTDGYEYDKDSYTNLYGSVPFLLAHASG
YNVGVFWMNPSDTFVKFDENKAFFISEGGFLDFVIIQGSFYEILNSYTLLTGRPQHPPLF
SLGYHQSRWDYKNLVTVKQVIKELDDANIPFDVFWLDIDHLEGKTPFTVSESFQPLEDLI
ELLDKQHRNLVRVCDPHFPTSVDNRQYKETRSRKLLVQTSKGMTFIGDSWPGQCSFPDFL
NTAVRDYWAKQFNYGMDVTGQNVFYWNDMNEPSIFKNYESTFPKDNIHFGGVENREVHNI
YGHLNSFSTFDGLLHRNNDQNIRPFVLSRSFFSGSQRYAFTWSGDNTATWDHLHTSVHMA
ITSGICGIPLTGSDVGGFLRSPDELLLTRWMQLGSLCYPFFREHCHHKSQRREPSNYEGE
TLNALRNAIINRYKLLPTIYTFAYESSQTGSPITRPLFAEFPDNDDSHENGEDFMIGDLV
LVKPIVDEDDEEKETEKLNYIEMYNTKFFPLPMYGIKGNEKVKSDEISKYPVYLREGKIL
PLFSTVTKNTHETLRSSDIDLVIALNEEGTAKGRLYLDDGISYNYKNGEYLYVELSYKDG
KVSYQRIGDKEQTIPDFLATKKISNVIILEAGKEPNTIKLDISF
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgtttggaatattacttcgtatttcatattcagcaattagaacatgcgaagatttagat
ttttgtgcggagaatatcggaaagtcccaaacgtgggccattgacaagtctacaatcatc
gcaaacgattctgtttattttacaatgcagaatgaagaaaagaaaagcaaaatatctttc
caaatcagctacatagcaaatgttggctttagatttagagctaatccaattcctgcagat
aatttctttagatacgatttatcaaacgaatctcttgtaattgatcaagatacaatcaaa
aacttagaagtattaaagtcagaaattggagataaaatcattcttaagcgcgattctatg
gctttaaccgtagaatttgaaccgtttaatatctacatcgaaaacaatggagaacgaatc
attaccattaatggcgaacaatccttactcttccaacatcatatggaagttgaagaacca
gataaatgggaatcttttacagatttgattccaaacggtccaacagccgtagcatgtgac
ttcaaattcgagaaggaaggcgttcatttcagtggtcttggcgaaagatcagctccatta
aatatagaaaaccaacaagagccaattcgcttatacaacacagatggttatgaatacgat
aaagattcatacacaaatctttacggatcagttccatttttgcttgcccatgcttctgga
tacaatgttggcgttttttggatgaatccatccgatacatttgttaaattcgacgaaaac
aaagctttcttcatcagtgaaggcggtttccttgactttgtcatcatccaaggctcattt
tacgaaatattaaattcatatacattattaacaggccgtccgcagcatccaccgctattt
tcattaggttaccatcaaagcagatgggattacaagaacttggtcactgtaaaacaagtt
attaaagaattagatgatgcgaacattccatttgatgttttctggcttgatatcgaccat
ttagaaggcaaaacaccatttacagttagcgaatccttccaacctcttgaagatctcatt
gaattattagataaacagcacagaaaccttgttcgagtctgcgatcctcattttccaaca
tcagtagataacaggcagtacaaagaaacccgttccaggaagcttttggtccaaacatca
aaaggaatgacttttatcggcgatagttggccaggacaatgttctttccctgatttcctt
aatacagcggtcagagattactgggccaagcagttcaattacggaatggacgttaccgga
caaaatgtattttattggaacgacatgaacgagccatccatcttcaagaactacgaatcg
acattccctaaggacaacatccactttggcggtgtcgaaaaccgagaagtccataacatc
tatggccatctaaattcattttcaacatttgatggtttattacatagaaacaacgaccaa
aacatccgcccctttgttctttcccgtagtttcttctcaggatcacagagatacgctttc
acatggtcaggagacaacacagcgacatgggaccacttacatacatcagttcacatggcc
attacatctggaatttgtggaattcctttgacaggctctgatgttggtggtttcttacga
tcacccgatgaattgttgttgacaaggtggatgcagttgggatctctctgttatcctttc
tttagagaacactgtcatcataaatcacaaagaagagaaccatcgaattacgaaggagaa
acattaaatgcattgagaaatgcaattattaatagatacaaactattaccaacaatatat
acatttgcatacgaatcatcacaaacaggatcaccaattacaagaccattgtttgcggag
ttcccagataatgatgattcacatgaaaatggcgaagatttcatgattggtgatttagtt
ttagttaaaccaattgttgatgaagatgatgaagaaaaagaaacagagaaattgaattac
atagagatgtataatactaagttcttcccattaccaatgtatggaataaaaggaaatgaa
aaagttaaatcagatgagatttctaaatatccagtttatttgagagaaggaaagatatta
ccactattcagtacagttacaaagaatacacacgaaacattgagatcatcagatattgat
cttgtcattgcattgaatgaagaaggaacagcgaaaggaagattgtatctggatgatgga
atttcttataactacaagaatggtgaatatctttatgtagaattatcttacaaagatgga
aaagtttcatatcaaagaattggagataaagaacaaactattcctgatttcttagctaca
aagaagatttctaatgttattattttggaagctggaaaagaaccaaatactatcaaatta
gatatttctttctaa

DBGET integrated database retrieval system