KEGG   Trichomonas vaginalis: TVAG_054600Help
Entry
TVAG_054600       CDS       T01022                                 

Definition
Thioredoxin family protein
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TVAG_054600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 377 aa AA seqDB search
MLLFLSILQYSTIDITNENEADIFSGKISKTPLFVEFYSPWCHHCSDFYPTWQKLVNISE
LNTKIQFARVDCPQYSKICDKHNINGYPTMVWYNLKENISVRYTGLNQIPFLQNFLERQL
KFPIQFIETETDINKYLHKTNRSSIFLLNYNDDNILANFRAIVLDFRATNALFFAYNSTN
QSLHVYREKDSYISYEGNWSNNSLAEFINDNINPLLMPFNNDEFEKSEKNGTFVVLFFLN
SSQQHYDFTKIVKKLPANYTYCYLENTDDYLAKFMSISKKMVPCIVIMNAKRNIWRVYRG
EFRSDLISNWIQLKDVKWLGPGDGRLSDFWIQVYSLKAQSMFIFVFICILLLIAISLIVF
VIASLIHDYLSIPLKNE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcttctctttctctctattttgcaatatagcacaatagacattacaaatgagaatgaa
gcagatattttttcaggaaaaatatccaaaacgcctttatttgtagaattttattctcct
tggtgccatcattgcagcgatttctacccaacatggcaaaaacttgtcaacatatctgaa
ttgaatacaaaaattcagtttgctagagttgattgtccacaatattcaaaaatatgcgat
aaacataatattaacggatatcctacaatggtatggtataaccttaaagaaaacataagc
gtaagatacacaggattaaatcaaattccatttctccaaaattttttggagcgacaactg
aaattcccaatacaattcattgaaacagaaacagatataaataaatacttacataaaacc
aacagatcatcaatattccttttgaattataatgacgacaatattttagcgaacttccga
gctatcgtattagattttagagctacaaatgcactatttttcgcatacaattcaaccaac
caatcattacatgtatatcgtgaaaaagattcttatatttcatatgaaggtaattggtcg
aacaattctttagcagaattcataaatgataacataaatccgttacttatgccgtttaat
aatgacgaattcgaaaaaagtgaaaaaaatggaacctttgttgttctctttttcctaaac
agtagccaacaacactatgatttcacaaaaatagtcaaaaaacttccagcaaattacact
tattgttatctcgaaaatactgatgattatcttgccaaattcatgtcaatttctaaaaag
atggtcccatgcattgtaattatgaatgcaaagaggaatatatggagagtttacagaggc
gaatttagaagtgacttaatttcaaattggattcaacttaaggacgtcaaatggcttgga
ccaggtgatggacgattgtctgacttttggattcaagtttacagcttgaaagcccaaagt
atgtttatatttgttttcatttgcatccttttactaatagcgatcagcttaattgttttt
gtgatcgcaagcttaattcatgattacctatcaatccctttaaaaaatgaataa

DBGET integrated database retrieval system