KEGG   Trichomonas vaginalis: TVAG_059170Help
Entry
TVAG_059170       CDS       T01022                                 

Definition
(RefSeq) acetylpolyamine aminohydrolase
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     TVAG_059170
Chromosome [BR:tva03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     TVAG_059170
   HDAC complexes
    Sin3A-HDAC complex
     TVAG_059170
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    TVAG_059170
  Chromatin remodeling factors
   NuRD complex
    TVAG_059170
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
AA seq 418 aa AA seqDB search
MSIPKNRIAYFYDEEIGNFYYEEGHPMKPVRVRMTHSLVLAYKLHNHLQVFRPHRATATE
MMRFHSPDYIKFLQNATPENSITSIQEQKRYCIGSDCPVFENIFEYCQISAGGSICAAQR
LNYNLADIAINWAGGLHHAAKEKPSGFCYIADCVLGIMELLKYHPRVMYIDIDIHHGDGV
EEAFYDSDRVLTCSFHKYGNDFFPGTGHVFDIGVDLGKYYAVNVPLRDGMTDEAYQFIFR
PIISRLIEWFVPSAIMLQCGADSLVGDRLGFFNLSTYGHGDCVSFVKSFGIPLLVVGGGG
YTKTSVARCWAYETSILTGVDIPNEMPETDYYDFYRPSYELHLKPDGKKNCNSREYLENV
MCHVIENIRHLPGAPSVQMQELPPRDMISAALRLPSDPDAAARNFTHQANNEDDENEE
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgagcattccaaaaaacagaattgcttacttctatgatgaagaaattggcaatttttac
tatgaggaaggccacccaatgaaacctgtaagagttcgtatgactcacagccttgtactc
gcatataaacttcataaccatttgcaggtcttcaggccccatcgtgctacagcaactgaa
atgatgcgcttccactcccccgattacattaaatttttgcaaaatgctacaccagaaaac
tcgattacaagtatccaagaacaaaaacgttattgcattggctcagattgcccagttttc
gagaacattttcgagtactgccaaatttccgctggtggaagtatctgcgccgctcaaaga
ttgaattataatcttgcagatatcgccatcaactgggcaggcggcctccatcatgctgcc
aaagagaagccaagtggcttctgctacattgcagactgcgttcttggaattatggagctt
ttgaaatatcatccaagagttatgtacattgatatcgatattcatcacggagatggtgtc
gaagaagcattttacgattcagatcgcgttcttacatgctcattccataaatacggaaat
gatttcttcccaggcaccggccacgtgtttgatattggtgtcgacctcggcaaatactac
gcagtcaatgtccctctcagagatggcatgacagatgaagcttaccaatttattttccga
ccaatcatttcaaggctcattgaatggtttgttccttccgcaattatgctacaatgtggc
gcagactcgttagtcggcgatcgtctaggtttcttcaacctctctacttacggacatgga
gattgtgtttcatttgtaaaaagctttggaattcctcttctcgttgtaggaggtggtgga
tatacaaagacaagcgttgctcgttgctgggcttacgagacatcaatcttaacaggcgtc
gatattccaaatgaaatgccagaaactgattattacgacttttaccgaccaagttacgaa
ctccatcttaaaccagatggaaagaagaactgcaatagcagagaatacctcgaaaacgtt
atgtgccatgttattgaaaacattagacatttaccaggagctccttcagtccaaatgcag
gagttaccacctagggatatgatttcggcagcattacgcttgccttctgatccagatgct
gctgctcgcaattttacccaccaggcaaataatgaagacgatgaaaacgaagaataa

DBGET integrated database retrieval system