KEGG   Trichomonas vaginalis: TVAG_059320Help
Entry
TVAG_059320       CDS       T01022                                 

Definition
acetyltransferase, GNAT family protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TVAG_059320
Transcription machinery [BR:tva03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TVAG_059320
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MNNDLIWLNREPHYKNLRINPGIRHISRLHVKPRSFQHSDPKTKTYVDDYQGIQIKIVEN
YYKVHPQALMLLNSCKSVFSSQLPNMEISYIVRQIFDYHCYSVTILREGTVISAITSRLF
PEKDVNFLEIIFVSVLSEYQSGGYGRLIMNYLKQLMQSIECYDAITCADNDAVKYFCKQG
FNTEKILMNPNRWIGRIKDYNGVTTSYLHVDPYINYYTFNREVRLQMKSLENRYGKRFHI
IPPELLDTPPTDLEGRQSIACIPLEKLYQLTENSSTDKEFVQAKLEEYNQKKEALLEQLK
ETVEKCESQLEITKSNSNNNNSELFAEFTAIKRRLRQSPDYYKSIQMLFGDLYHLSEFLK
RSNKKKNSFISMLNSMKKDYGIE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgatctaatttggttgaaccgggaacctcattataaaaacttgagaataaac
ccaggaattcggcatatatcaagacttcatgtcaagcctcgatcttttcagcactccgat
ccaaaaacaaaaacatatgttgatgattatcaaggtattcagattaaaatcgtagaaaat
tattacaaagttcatccacaagcactcatgcttttaaatagctgtaaatcagttttttca
tcacaattaccaaacatggaaataagttacatcgttcgtcaaatttttgactatcattgc
tattcagtgacaattcttcgagaaggtactgtaatttctgctattacatctcgtttgttt
ccagaaaaagatgtcaattttttggaaatcatctttgtttcggtcttatccgaataccaa
agtggaggttatggtcggttaatcatgaattacttaaaacaacttatgcaatcaatagaa
tgctacgatgctattacttgtgcagacaacgacgccgttaaatacttttgtaagcaaggt
ttcaatacagaaaagattcttatgaatcctaatcgatggattggccgcattaaagattat
aatggtgtcacaacttcgtatttacacgttgatccatatatcaactattatacatttaac
cgagaagtcagactccagatgaaatcgcttgaaaatcggtatggtaaacgatttcatatt
attccgccagaattattagatactccaccaacagaccttgaaggaaggcagagcatagca
tgtatccctctagagaaattatatcagcttacagaaaacagtagtactgacaaagaattt
gtccaagctaaacttgaagagtacaatcagaagaaagaagctcttttggaacagctcaaa
gagacagtagaaaaatgtgaatctcagctcgaaattacgaaatctaatagtaataacaat
aattcagaactttttgcagaatttactgctattaaaagaagactccgtcaatcaccagat
tattataaatccattcaaatgcttttcggagatttatatcatctctcagaatttctgaaa
cgatctaataagaaaaagaactccttcatctcaatgttaaacagcatgaagaaagattac
ggtattgaataa

DBGET integrated database retrieval system