KEGG   Trichomonas vaginalis: TVAG_059320Help
Entry
TVAG_059320       CDS       T01022                                 

Definition
acetyltransferase, GNAT family protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tva  Trichomonas vaginalis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 383 aa AA seqDB search
MNNDLIWLNREPHYKNLRINPGIRHISRLHVKPRSFQHSDPKTKTYVDDYQGIQIKIVEN
YYKVHPQALMLLNSCKSVFSSQLPNMEISYIVRQIFDYHCYSVTILREGTVISAITSRLF
PEKDVNFLEIIFVSVLSEYQSGGYGRLIMNYLKQLMQSIECYDAITCADNDAVKYFCKQG
FNTEKILMNPNRWIGRIKDYNGVTTSYLHVDPYINYYTFNREVRLQMKSLENRYGKRFHI
IPPELLDTPPTDLEGRQSIACIPLEKLYQLTENSSTDKEFVQAKLEEYNQKKEALLEQLK
ETVEKCESQLEITKSNSNNNNSELFAEFTAIKRRLRQSPDYYKSIQMLFGDLYHLSEFLK
RSNKKKNSFISMLNSMKKDYGIE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgatctaatttggttgaaccgggaacctcattataaaaacttgagaataaac
ccaggaattcggcatatatcaagacttcatgtcaagcctcgatcttttcagcactccgat
ccaaaaacaaaaacatatgttgatgattatcaaggtattcagattaaaatcgtagaaaat
tattacaaagttcatccacaagcactcatgcttttaaatagctgtaaatcagttttttca
tcacaattaccaaacatggaaataagttacatcgttcgtcaaatttttgactatcattgc
tattcagtgacaattcttcgagaaggtactgtaatttctgctattacatctcgtttgttt
ccagaaaaagatgtcaattttttggaaatcatctttgtttcggtcttatccgaataccaa
agtggaggttatggtcggttaatcatgaattacttaaaacaacttatgcaatcaatagaa
tgctacgatgctattacttgtgcagacaacgacgccgttaaatacttttgtaagcaaggt
ttcaatacagaaaagattcttatgaatcctaatcgatggattggccgcattaaagattat
aatggtgtcacaacttcgtatttacacgttgatccatatatcaactattatacatttaac
cgagaagtcagactccagatgaaatcgcttgaaaatcggtatggtaaacgatttcatatt
attccgccagaattattagatactccaccaacagaccttgaaggaaggcagagcatagca
tgtatccctctagagaaattatatcagcttacagaaaacagtagtactgacaaagaattt
gtccaagctaaacttgaagagtacaatcagaagaaagaagctcttttggaacagctcaaa
gagacagtagaaaaatgtgaatctcagctcgaaattacgaaatctaatagtaataacaat
aattcagaactttttgcagaatttactgctattaaaagaagactccgtcaatcaccagat
tattataaatccattcaaatgcttttcggagatttatatcatctctcagaatttctgaaa
cgatctaataagaaaaagaactccttcatctcaatgttaaacagcatgaagaaagattac
ggtattgaataa

DBGET integrated database retrieval system