KEGG   Trichomonas vaginalis: TVAG_062000Help
Entry
TVAG_062000       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
tva  Trichomonas vaginalis
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    TVAG_062000
  Replication and repair
   03420 Nucleotide excision repair
    TVAG_062000
Transcription machinery [BR:tva03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     TVAG_062000
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 286 aa AA seqDB search
MDFNKSTQARNWLFFPEELEELRRGNYNEIGEIVSSNISYEDYRGYIQYYADELLKYAAK
IEIWNSYQVYTALALYQRVYVRKTIWDIPPPLAMMNALFIVCKFIFPIKFSELVRVAGFK
QELIDRFKPYEQIAKSEVICLTGWKFNLKIHLPIHHLYGIVDGRLDRESFEKCLECLKQI
LQTDALLLFPPGQIAFAAVAITCGMDTAVSFLPEAKQGTDPNVPLVDELAQVTEAIQNLK
KPEYDPARCMQVEEQYGIEYVVQETLTRAQAQPENPTEKSIVPPSA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaacaagtcaactcaggcacgaaactggttatttttccctgaagaacttgaa
gaattgaggagaggcaactacaatgaaatcggagaaattgtttcttctaatatttcttat
gaagattatcgtggatatattcaatattacgcagacgagttacttaagtatgctgcaaag
attgaaatatggaattcatatcaagtatatacagcattagctctttatcagcgtgtttac
gtaagaaaaacaatttgggacattcctcctccattggcaatgatgaatgccctctttatt
gtttgcaaattcattttcccaattaaattctcagaattggtccgagttgcaggcttcaaa
caagaattaattgacagatttaaaccatacgaacagattgctaaatctgaagttatctgc
cttacaggatggaaattcaatctcaaaatccatcttcctatccaccatttatatggaatt
gttgatggaagactcgatagagaaagttttgagaaatgcttagaatgtctcaaacaaatt
cttcaaacagatgcattactactcttccctccaggccaaattgcattcgctgccgttgca
attacttgcggaatggatacagcagtttcattccttcctgaagccaaacagggaacagat
ccaaacgttccgctggtagatgaattggcccaagttactgaggccattcaaaacctcaag
aaacctgaatatgatccagcaaggtgcatgcaagtagaagaacaatatggtattgaatat
gttgttcaggaaacattaacaagggcacaagctcagccagaaaatccaacagaaaaatca
attgtccctccatccgcttaa

DBGET integrated database retrieval system