KEGG   Trichomonas vaginalis: TVAG_074640Help
Entry
TVAG_074640       CDS       T01022                                 

Definition
(RefSeq) O-Glycosyl hydrolase family 30 protein
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
tva00511  Other glycan degradation
tva00600  Sphingolipid metabolism
tva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_074640
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_074640
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_074640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 4770603
NCBI-ProteinID: XP_001324859
UniProt: A2E3Y1
AA seq 478 aa AA seqDB search
MLTSLCMSNLGPHREGFRGLPNADDVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINP
DSKFQTIDGFGAAITGSTAYNLNQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSL
KDFTDCDKEGIDNFALDSEDTDLIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLFTLR
RHNSFISGYLDPRLYQEYATYFVKYVQAMAKYNLHIYAITVQNEPLNKGNSASCFMGYKQ
QRDFIKTALGPQFAANNISTKIIIYDHNYNYDNIITQQHYPVHIYDDAEANKYIDGAAYH
AYGGSNTEMDYVTSKYPNKNLYFTEMSIGEWNYDFQGDLMWNTREIGIGTLNKGSKCAIM
WNLLLDTNHGPYRPKGCSNCYGAVDVKVPGYSELIYRSHYYDMAHLSKVIKPDSIRLGTT
VSGSSNVYATSAINTNGYIGAVLLNDQDQDVTVSVQCGSHAFDVPMPKRSVVSVIWKQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcttacctccctttgtatgtcaaatctaggtcctcatagagaaggatttcgtggatta
ccaaatgcagatgatgtgtatgcatatacaacaacaggcgatcaaagcaaacttttcgaa
ccatctgtaatttcatttaataaggtttctggcaataatccaactgttgtcatcaatcca
gactcaaagttccaaacaatcgatggatttggagctgctattacaggttctacagcatat
aacttaaatcaaatgactcaagaagcaagagacaagttccttaaagatacattcgatcca
gacacaggtatgggttattctttcattcgtatttctatcggctgctcagacttttctctc
aaagatttcacagattgtgataaagaaggaattgacaatttcgcacttgattccgaagat
acagaccttatcatcccaattatacagcaaattctcaagattaacccttctgttaaaatc
attgcaactccatggactcctcctatttggatgaaggtttcagacttgtttacccttaga
agacataattccttcatttctggctaccttgatccaagactttaccaagaatatgctact
tattttgtcaaatacgtccaagcaatggccaaatacaatttacacatctacgccatcaca
gtacaaaatgagccacttaataaaggcaactccgcttcttgtttcatgggctacaagcaa
caaagagattttattaagacagctcttggtccacagttcgctgcaaacaacatttcgaca
aagattattatttacgaccacaattataactacgataacattattactcaacaacattat
ccagttcacatttacgatgacgccgaggctaataaatacattgatggtgctgcttatcat
gcttatggtggttccaacacagaaatggactatgttactagcaaatatccaaataagaat
ttatatttcacagaaatgtcaattggcgaatggaattacgatttccagggtgacttgatg
tggaatacacgtgagatcggtatcggaacccttaacaaaggcagcaaatgtgcaattatg
tggaatttgcttcttgatacaaaccatggaccatatcgtccaaagggatgctccaattgc
tatggagcagttgatgttaaagttcctggctactcagaactcatttacaggtctcattac
tatgatatggcacatctttccaaagttattaagccagactcaatcagacttggaacaact
gtctcaggaagctcaaatgtctatgcaacatcagctattaacacaaatggatacattggc
gctgttttacttaatgatcaggaccaagacgtcacagtttcagtccaatgtggctcccat
gcatttgatgtcccaatgccaaagagatctgttgtttccgtcatttggaaacaataa

DBGET integrated database retrieval system