KEGG   Trichomonas vaginalis: TVAG_074640Help
Entry
TVAG_074640       CDS       T01022                                 

Definition
O-Glycosyl hydrolase family 30 protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
tva  Trichomonas vaginalis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TVAG_074640
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TVAG_074640
Enzymes [BR:tva01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     TVAG_074640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 478 aa AA seqDB search
MLTSLCMSNLGPHREGFRGLPNADDVYAYTTTGDQSKLFEPSVISFNKVSGNNPTVVINP
DSKFQTIDGFGAAITGSTAYNLNQMTQEARDKFLKDTFDPDTGMGYSFIRISIGCSDFSL
KDFTDCDKEGIDNFALDSEDTDLIIPIIQQILKINPSVKIIATPWTPPIWMKVSDLFTLR
RHNSFISGYLDPRLYQEYATYFVKYVQAMAKYNLHIYAITVQNEPLNKGNSASCFMGYKQ
QRDFIKTALGPQFAANNISTKIIIYDHNYNYDNIITQQHYPVHIYDDAEANKYIDGAAYH
AYGGSNTEMDYVTSKYPNKNLYFTEMSIGEWNYDFQGDLMWNTREIGIGTLNKGSKCAIM
WNLLLDTNHGPYRPKGCSNCYGAVDVKVPGYSELIYRSHYYDMAHLSKVIKPDSIRLGTT
VSGSSNVYATSAINTNGYIGAVLLNDQDQDVTVSVQCGSHAFDVPMPKRSVVSVIWKQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcttacctccctttgtatgtcaaatctaggtcctcatagagaaggatttcgtggatta
ccaaatgcagatgatgtgtatgcatatacaacaacaggcgatcaaagcaaacttttcgaa
ccatctgtaatttcatttaataaggtttctggcaataatccaactgttgtcatcaatcca
gactcaaagttccaaacaatcgatggatttggagctgctattacaggttctacagcatat
aacttaaatcaaatgactcaagaagcaagagacaagttccttaaagatacattcgatcca
gacacaggtatgggttattctttcattcgtatttctatcggctgctcagacttttctctc
aaagatttcacagattgtgataaagaaggaattgacaatttcgcacttgattccgaagat
acagaccttatcatcccaattatacagcaaattctcaagattaacccttctgttaaaatc
attgcaactccatggactcctcctatttggatgaaggtttcagacttgtttacccttaga
agacataattccttcatttctggctaccttgatccaagactttaccaagaatatgctact
tattttgtcaaatacgtccaagcaatggccaaatacaatttacacatctacgccatcaca
gtacaaaatgagccacttaataaaggcaactccgcttcttgtttcatgggctacaagcaa
caaagagattttattaagacagctcttggtccacagttcgctgcaaacaacatttcgaca
aagattattatttacgaccacaattataactacgataacattattactcaacaacattat
ccagttcacatttacgatgacgccgaggctaataaatacattgatggtgctgcttatcat
gcttatggtggttccaacacagaaatggactatgttactagcaaatatccaaataagaat
ttatatttcacagaaatgtcaattggcgaatggaattacgatttccagggtgacttgatg
tggaatacacgtgagatcggtatcggaacccttaacaaaggcagcaaatgtgcaattatg
tggaatttgcttcttgatacaaaccatggaccatatcgtccaaagggatgctccaattgc
tatggagcagttgatgttaaagttcctggctactcagaactcatttacaggtctcattac
tatgatatggcacatctttccaaagttattaagccagactcaatcagacttggaacaact
gtctcaggaagctcaaatgtctatgcaacatcagctattaacacaaatggatacattggc
gctgttttacttaatgatcaggaccaagacgtcacagtttcagtccaatgtggctcccat
gcatttgatgtcccaatgccaaagagatctgttgtttccgtcatttggaaacaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system