KEGG   Trichomonas vaginalis: TVAG_075290Help
Entry
TVAG_075290       CDS       T01022                                 

Definition
(RefSeq) Histone H2B
  KO
K11252  
histone H2B
Organism
tva  Trichomonas vaginalis
Brite
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TVAG_075290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MSSKKPASKTPTEKKPAVEGVDAANAAKQDKKLRHKKRAETFSSYIFKVLKQVHPDIGIS
NKAMMVMNSFVTDIFERIAQEGARLVDMNERNTLGSREVQTAVRLVLPGDLAKHAVSEGG
KAVAKFNAE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcttccaagaagccagcctctaaaacaccaacagagaagaagccagccgtcgagggc
gtcgatgctgcaaacgccgccaagcaagataagaagctccgccacaagaagcgtgctgaa
acattctcatcctacatcttcaaggttcttaagcaagtccacccagatatcggtatctcc
aacaaggctatgatggtcatgaactccttcgttacagatatcttcgaacgtattgcccaa
gaaggtgctcgccttgtcgatatgaacgaacgtaacactctcggttcccgcgaagttcag
acagctgttcgtcttgttcttccaggcgatcttgccaagcacgccgtctcagaaggtggc
aaggctgtcgccaagttcaatgctgaataa

DBGET integrated database retrieval system