KEGG   Trichomonas vaginalis: TVAG_076340Help
Entry
TVAG_076340       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
tva  Trichomonas vaginalis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:tva03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MLLDADDLDLSGSGSGSENEDKSEDNAWDAPAAVPTKKEEPVFESWEDAPDYEELERQKK
EAEERAAREKQEAIEAEKRRKEEKKAFREAAKARLMESSSDDEGGLFDIEAAHEQEKHQD
FAVAMDMLGATNEKVTVDDYMNFVPRVVSDFNGLRQKLVEVLKQKVDFKSKEAPQLLAYF
IRCLIDDYKGEQMKTLDSELIKIINEKLQQTRAKQGKNTKKKTSTKVYMNIKDDGKDNDD
DFM
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctgttagatgctgacgatctcgacctttccggctcaggatcagggtcggaaaatgag
gataagtcggaagataatgcttgggatgccccagcagccgttccaacaaagaaggaagaa
cctgtattcgaaagttgggaagatgccccagattacgaagaattagaacgccaaaagaaa
gaggctgaagagagagctgctagagaaaaacaggaagcaatcgaagccgaaaaacgtcgt
aaggaagaaaagaaagcattcagagaagctgcaaaagctagattaatggaatcttctagt
gatgatgaaggtggcctcttcgatattgaagctgcccacgaacaggaaaagcaccaggac
ttcgctgtcgctatggatatgttaggcgctacaaacgaaaaagttacagtcgatgattac
atgaacttcgttccacgcgtcgtctctgacttcaacggtcttcgccagaagcttgtagaa
gttcttaagcagaaagttgacttcaaatccaaggaagctccacaattacttgcatatttc
attcgctgcctcattgatgattataagggtgaacaaatgaaaacactcgattctgaactc
atcaaaataatcaacgaaaaattacaacaaactcgtgctaaacagggtaagaacacgaag
aagaagacatccacaaaggtctatatgaatataaaagatgacggcaaagataatgacgac
gactttatgtaa

DBGET integrated database retrieval system