KEGG   Trichomonas vaginalis: TVAG_096350Help
Entry
TVAG_096350       CDS       T01022                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tva  Trichomonas vaginalis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TVAG_096350
   01230 Biosynthesis of amino acids
    TVAG_096350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_096350
   00051 Fructose and mannose metabolism
    TVAG_096350
   00562 Inositol phosphate metabolism
    TVAG_096350
Enzymes [BR:tva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TVAG_096350
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TVAG_096350
  Exosomal proteins of bladder cancer cells
   TVAG_096350
  Exosomal proteins of melanoma cells
   TVAG_096350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
AA seq 252 aa AA seqDB search
MRTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFVFLPTLQQKLRKDWKV
SAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGM
KIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQ
DAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAG
FINIVNSNVHSK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaacattcttcgtcggtggtaactggaaggctaatccaaagacagtccaagaggct
gagaagcttgtcgaaatgctcaacggcgctaaggttgagggcaacgtcgaagttgttgtt
gctgctccattcgttttcctcccaacactccagcagaagctccgcaaggactggaaggtc
agcgctgagaacgtcttcacaaagccaaacggtgctttcacaggtgaagttacagtccca
atgatcaagtcattcggcatcgagtggacaatcctcggccactccgagcgccgtgacatc
ctcaaggaagatgatgaattccttgctgccaaggccaagttcgctcttgagaacggcatg
aagatcatctactgctgcggtgagcacctttctgaacgcgaagccggcaaggcctccgag
ttcgtctctgctcagatcgagaagatgatcccagctatcccagccggcaagtgggacgat
gttgtcatcgcttacgaaccaatctgggctatcggcacaggcaaggttgcttccacacag
gatgctcaggaaatgtgcaaggttatccgtgacatccttgctgctaaggttggcgctgat
atcgctaacaaggtccgcattctctacggcggttccgtcaagccaaacaactgcaacgag
ctcgctgcctgcccagatgtcgatggcttcctcgttggtggtgcttccctcgaagccggc
ttcatcaacattgtcaactccaatgtccactccaagtaa

DBGET integrated database retrieval system