KEGG   Trichomonas vaginalis: TVAG_096350Help
Entry
TVAG_096350       CDS       T01022                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tva  Trichomonas vaginalis
Pathway
tva00010  Glycolysis / Gluconeogenesis
tva00051  Fructose and mannose metabolism
tva00562  Inositol phosphate metabolism
tva01100  Metabolic pathways
tva01110  Biosynthesis of secondary metabolites
tva01130  Biosynthesis of antibiotics
tva01200  Carbon metabolism
tva01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TVAG_096350
   00051 Fructose and mannose metabolism
    TVAG_096350
   00562 Inositol phosphate metabolism
    TVAG_096350
Enzymes [BR:tva01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TVAG_096350
Exosome [BR:tva04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TVAG_096350
  Exosomal proteins of bladder cancer cells
   TVAG_096350
  Exosomal proteins of melanoma cells
   TVAG_096350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM DUF5016 AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 4749642
NCBI-ProteinID: XP_001304868
UniProt: A2FT29
Structure
PDB: 

Jmol
AA seq 252 aa AA seqDB search
MRTFFVGGNWKANPKTVQEAEKLVEMLNGAKVEGNVEVVVAAPFVFLPTLQQKLRKDWKV
SAENVFTKPNGAFTGEVTVPMIKSFGIEWTILGHSERRDILKEDDEFLAAKAKFALENGM
KIIYCCGEHLSEREAGKASEFVSAQIEKMIPAIPAGKWDDVVIAYEPIWAIGTGKVASTQ
DAQEMCKVIRDILAAKVGADIANKVRILYGGSVKPNNCNELAACPDVDGFLVGGASLEAG
FINIVNSNVHSK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgagaacattcttcgtcggtggtaactggaaggctaatccaaagacagtccaagaggct
gagaagcttgtcgaaatgctcaacggcgctaaggttgagggcaacgtcgaagttgttgtt
gctgctccattcgttttcctcccaacactccagcagaagctccgcaaggactggaaggtc
agcgctgagaacgtcttcacaaagccaaacggtgctttcacaggtgaagttacagtccca
atgatcaagtcattcggcatcgagtggacaatcctcggccactccgagcgccgtgacatc
ctcaaggaagatgatgaattccttgctgccaaggccaagttcgctcttgagaacggcatg
aagatcatctactgctgcggtgagcacctttctgaacgcgaagccggcaaggcctccgag
ttcgtctctgctcagatcgagaagatgatcccagctatcccagccggcaagtgggacgat
gttgtcatcgcttacgaaccaatctgggctatcggcacaggcaaggttgcttccacacag
gatgctcaggaaatgtgcaaggttatccgtgacatccttgctgctaaggttggcgctgat
atcgctaacaaggtccgcattctctacggcggttccgtcaagccaaacaactgcaacgag
ctcgctgcctgcccagatgtcgatggcttcctcgttggtggtgcttccctcgaagccggc
ttcatcaacattgtcaactccaatgtccactccaagtaa

DBGET integrated database retrieval system