KEGG   Trichomonas vaginalis: TVAG_096490Help
Entry
TVAG_096490       CDS       T01022                                 

Definition
3-oxo-5-alpha-steroid 4-dehydrogenase family protein
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
tva  Trichomonas vaginalis
Brite
Enzymes [BR:tva01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TVAG_096490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 270 aa AA seqDB search
MIENYILDYSGLKVFMATMSIIGVFVFIALYFINAGYGKFASRSWGPAIPNKLAWILMEC
PVFIVLCILWYFSERRFQLIYLTFFIIFQIHYFQRSFIFPFLLKGKSYMPILIMLMGATF
NVCNGYIQGCWLFYTAPEGYYTNEWFCTPQFIIGTIIFFTGMFINIHSDHVIRNLRKPGD
TKHCLPNKGMYRFVTSANYLGEIIEWFGYFILTLSPAALVFVWFTFANLVPRAHKIYDRY
LKEFGKPVLEKKRIFPFRSGMRGFQGLRPF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaaactacatcctcgactactcaggtctaaaggtattcatggcaacaatgtcc
attattggtgtctttgtcttcattgccttatacttcattaacgccggctatggcaaattc
gccagtagatcatggggaccagctattccgaacaagttagcatggatcttaatggaatgc
ccagtattcatcgttctctgcatcctttggtacttctctgaaagaagattccagttgatt
tatctcacattctttattatcttccagatccactacttccagagatcattcatcttccca
ttccttcttaaaggcaaatcatacatgccaatccttatcatgctcatgggagctacattc
aacgtttgcaacggatatatccaaggctgctggctattctacactgcaccagaaggatac
tatacaaatgaatggttctgcacaccacagttcatcattggaaccatcattttcttcaca
ggaatgtttattaacattcactcagaccatgtcatcagaaacttacgcaaaccaggtgat
acaaagcactgccttccaaacaagggtatgtacagatttgtaacatccgcaaactatctc
ggtgaaattatcgaatggtttggatatttcatattgacattatcaccagccgctctcgta
tttgtttggttcacatttgctaatcttgtcccacgtgctcacaagatttatgaccgttat
ctcaaggaattcggaaaaccagtccttgaaaagaagcgtatcttcccattcaggtcaggt
atgaggggcttccaggggctgcgccccttctag

DBGET integrated database retrieval system