KEGG   Trichomonas vaginalis: TVAG_097340Help
Entry
TVAG_097340       CDS       T01022                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
tva  Trichomonas vaginalis
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tva00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    TVAG_097340
   03420 Nucleotide excision repair
    TVAG_097340
   03430 Mismatch repair
    TVAG_097340
   03440 Homologous recombination
    TVAG_097340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 241 aa AA seqDB search
MFNIKFRTFFYPLSYDPITEQLVFFSFRISVRTQLFYNHTFLQIYLNILFKVKSRKQVSI
VGKIISHEDSTISIDYLVNDCTGSIKVKNFISDDNPEPIPDGTYVFVVGRITPAIEDGIS
SFTIKPITEFDQIPYHMLYSLFVHLQTTRGTPPDSSFAQAPKHIETAPPPMRSSEDRDEK
IKNDVIEFLKENNSDRGTPEEQIIQHFSHIYSAEEVKKAVETANFNGEIYSTSEDNCYNP
C
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacattaaatttagaacattcttttatcctctttcatatgatccaataacagaa
caattagtttttttttcattcagaatctccgtaagaacacaacttttttataatcataca
tttctgcagatatacttaaacatcttgttcaaggttaaatcaagaaaacaagtatccatc
gtaggaaagattattagccatgaagatagcacaatcagcattgattacttggtgaatgat
tgtacaggcagtatcaaagttaagaatttcatttcagatgataatccagagccaattcca
gatggaacatacgtttttgttgttggaagaattacacctgctattgaagatggaatatct
tcattcacaatcaaacccataacagaattcgatcaaattccttatcatatgctttactca
ttgttcgtacacttacagacaacaagaggaacacccccagactcctctttcgctcaagca
ccaaagcatattgaaacagcacctcctccaatgcgatcaagcgaagacagagatgaaaag
attaagaacgatgtcattgaattcctcaaagagaacaattcagatcgcggaactccagaa
gaacaaattattcaacatttctcacacatatactctgcagaagaagttaagaaagcagtt
gaaacagcaaactttaatggtgaaatctactctacaagcgaagataattgttataatcct
tgctaa

DBGET integrated database retrieval system