KEGG   Trichomonas vaginalis: TVAG_100620Help
Entry
TVAG_100620       CDS       T01022                                 

Definition
Profilin A
Orthology
K05759  
profilin
Organism
tva  Trichomonas vaginalis
Brite
Exosome [BR:tva04147]
 Exosomal proteins
  Proteins found in most exosomes
   TVAG_100620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 122 aa AA seqDB search
MSWNDQLVSLKTESSGCAIITQQGALCAKEGAWKATQDELLKYITYFTEPSPALSGLYYG
GEKYICNQANADMVFAMKGKQAVVLQKTKTLIIAGYTDGQFHPAALSASVGKVAQYLTSS
NL
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgtcctggaacgatcagctcgtctctcttaagacagaatcctctggctgcgctatcatc
acacaacaaggtgccctttgcgctaaggaaggcgcctggaaggccacacaggacgaactc
cttaagtacatcacatacttcacagagccatccccagctctctctggcttatactatggt
ggcgagaagtacatctgcaaccaggctaacgctgatatggtcttcgccatgaagggcaag
caggctgttgtcctccagaagacaaagacactcatcatcgccggctacacagatggccag
ttccatccagctgccctttctgcctccgtcggcaaggtcgctcagtacctcacatcatct
aacctctaa

DBGET integrated database retrieval system