KEGG   Trichomonas vaginalis: TVAG_102390Help
Entry
TVAG_102390       CDS       T01022                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase family protein
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tva  Trichomonas vaginalis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tva00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TVAG_102390
   00052 Galactose metabolism
    TVAG_102390
   00500 Starch and sucrose metabolism
    TVAG_102390
   00520 Amino sugar and nucleotide sugar metabolism
    TVAG_102390
Enzymes [BR:tva01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TVAG_102390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 473 aa AA seqDB search
MSTVREIFEKDEAAGLKAFEEKIKPLGLSEGAKEKLLYMFKSAFSKASAADCMIDWQYVV
PLTDKEQTPYETLKDPENPAELLKKLVIVKLNGGLGTTMGCTGPKSLISCRNGKSFFDIV
VDQVKELNDKYGTDVPLVLMHSFNTDDIMRPHVEAVKDVKVITFNQNKFPRIYTDTLEPV
PENAESPISMWNPPGHADVYHCLRDSGLLDKFLAEGKTIMMISNIDNLGSVVDLKVLNKA
ITENRSYMAETVLKTLDDWKGGMPIMYKGHMKLLETAIVPKEHFNDYTDMNFLNYFHANN
LWVNLVTLKQALSDGTLKLDTMRNYKKYNNREIVQLEAACGSAIQSFKDSCAVRVPRNRF
LPVKSCNELLLVRANVYIMEGSHFVRNPARKIADLPSIQLSQIYQHVEDFEKRFPEAPDM
VDLVKLHVDGDVFFGKNIKLVGNVDIQIPAGQTLTIPDGKVLKDCTIRSAADL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagtacgcgagattttcgagaaagacgaagcagcaggccttaaggctttcgaa
gagaagatcaaaccactcggtttatctgaaggcgccaaggaaaaattactttacatgttc
aaatcagccttttccaaggcatctgctgccgattgcatgattgactggcaatatgtcgtt
ccacttacagacaaggaacaaacaccatacgagacacttaaggatccagaaaatccagct
gaactcctcaagaagctcgttatcgtcaagctcaatggtggccttggcacaacaatgggc
tgcacaggaccaaagtctctcatctcctgcagaaacggcaagtcattcttcgacattgtt
gttgaccaggtcaaggagctcaacgacaagtacggaactgatgttccacttgttctcatg
cactccttcaacacagacgacatcatgagaccacatgttgaagctgtcaaggatgtcaaa
gttatcacattcaaccaaaacaagttcccacgtatctacacagacacacttgagccagtc
ccagagaatgccgagtccccaatctcaatgtggaacccaccaggccacgcagatgtttac
cattgcctccgtgactctggcttacttgacaagttcctcgctgaaggaaagacaatcatg
atgatctccaacatcgataaccttggctctgttgtcgacctcaaggttctcaacaaggca
attacagaaaaccgctcatacatggccgaaacagtcctcaagacacttgatgactggaag
ggtggcatgccaatcatgtacaagggccacatgaagcttcttgaaacagctattgttcca
aaggagcatttcaacgattacacagatatgaacttcctcaactacttccacgccaacaac
ttatgggtcaaccttgttacactcaagcaggctctttccgatggaacactcaaactcgat
acaatgagaaactacaagaagtacaacaaccgtgaaattgtacaattagaagctgcttgc
ggctctgcaatccagtccttcaaggattcatgcgctgtcagagttccaagaaacagattc
cttccagtcaagtcttgcaacgaattactattagtcagagctaacgtttacatcatggag
ggatcccacttcgtccgcaatccagccagaaagatcgctgaccttccatccatccaactt
tctcaaatctaccaacacgtcgaagactttgagaagagattcccagaagctccagacatg
gtagatctcgtcaagctccacgtcgatggtgatgtcttcttcggcaagaacatcaaactt
gtcggaaacgtcgacatccagattccagctggccagacactcacaatcccagacggaaag
gttctcaaggactgcacaattcgcagtgctgctgatttgtaa

DBGET integrated database retrieval system